Myxocyprinus asiaticus (Chinese sucker): 127427992 Help Entry 127427992         CDS       T08782                                  Name (RefSeq) insulin-like isoform X1   KO K04526   insulin Organism masi  Myxocyprinus asiaticus (Chinese sucker) Pathway masi04010   MAPK signaling pathway masi04068   FoxO signaling pathway masi04081   Hormone signaling masi04114   Oocyte meiosis masi04140   Autophagy - animal masi04150   mTOR signaling pathway masi04810   Regulation of actin cytoskeleton masi04910   Insulin signaling pathway masi04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:masi00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     127427992    04150 mTOR signaling pathway     127427992   09133 Signaling molecules and interaction    04081 Hormone signaling     127427992  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     127427992  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:masi04052]     127427992 Cytokines and neuropeptides [BR:masi04052]  Neuropeptides   Unclassified    127427992 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta KicB Motif Other DBs NCBI-GeneID:  127427992 NCBI-ProteinID:  XP_051531978 LinkDB All DBs Position 3:33257554..33262604 Genome browser AA seq 101 aa AA seqDB search MAVWLQAGALLFLLAVSIVNTNGETQHRLCGSDLVGAFMRVCGSSKRDVDLLLGFIPPQS GQENEVSDFAFKDHAELIRKRGIVEQCCFNTCTYTELKNYC NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcagtgtggctccaggctggtgctttgctgttcctcttggctgtctctattgtcaac acaaatggagaaacccagcatcgtctgtgtggatctgaccttgttggagcatttatgcgg gtctgtggcagctccaagagagatgttgacctcctcctgggtttcattcctcctcaatct ggccaggaaaatgaggtgtctgactttgcatttaaagatcatgctgagctgataaggaag agaggcattgtggagcagtgttgcttcaacacatgcacatacactgaactgaagaattac tgctaa

DBGET integrated database retrieval system