Myxocyprinus asiaticus (Chinese sucker): 127428073 Help Entry 127428073         CDS       T08782                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism masi  Myxocyprinus asiaticus (Chinese sucker) Pathway masi04137   Mitophagy - animal masi04140   Autophagy - animal masi04142   Lysosome biogenesis masi04144   Endocytosis masi04145   Phagosome masi04148   Efferocytosis masi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:masi00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     127428073    04145 Phagosome     127428073    04142 Lysosome biogenesis     127428073    04140 Autophagy - animal     127428073    04137 Mitophagy - animal     127428073    04148 Efferocytosis     127428073  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127428073  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:masi04131]     127428073   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:masi04147]     127428073    04031 GTP-binding proteins [BR:masi04031]     127428073 Membrane trafficking [BR:masi04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     127428073 Exosome [BR:masi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127428073   Exosomal proteins of other body fluids (saliva and urine)    127428073   Exosomal proteins of colorectal cancer cells    127428073   Exosomal proteins of bladder cancer cells    127428073 GTP-binding proteins [BR:masi04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     127428073 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 NTPase_1 AAA_7 AAA_22 G-alpha AAA_5 AAA_24 ATPase_2 NB-ARC AAA_14 NACHT SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  127428073 NCBI-ProteinID:  XP_051532095 LinkDB All DBs Position 37:14599820..14613791 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatcaaggaagaaagttctactaaaggtgatcatccttggagactctggggttgga aagacatctctgatgaatcagtatgtgaataaaaagttcagtaatcagtataaagccact ataggagcagattttctgacaaaagaagtgatggttgacgatcgactcgtcacaatgcag atatgggacacagcaggtcaagagaggttccagtctttgggcgtggcattttaccgcggt gcagactgttgtgtgcttgtgttcgatgtcactgcccccaacactttcaaaacactggac agctggagggacgagttcttgatccaggccagcccacgtgacccagagaacttccccttt gtggtgctgggcaacaaaattgacctagagaataggcaggtagcaaccaagcgagcacag gcttggtgtcagagtaagaataacatcccatactttgagaccagtgcaaaagaggccatc aacgttgagcaggctttccagaccattgcacgtaatgcactcaaacaggaaaccgaagtg gagttatacaatgagtttcctgagccaattaaactagaccggaatgatagagccaagcca tcagcagagacttgtagctgctga

DBGET integrated database retrieval system