Myxocyprinus asiaticus (Chinese sucker): 127428350 Help Entry 127428350         CDS       T08782                                  Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism masi  Myxocyprinus asiaticus (Chinese sucker) Pathway masi04810   Regulation of actin cytoskeleton masi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:masi00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     127428350  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127428350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  127428350 NCBI-ProteinID:  XP_051532654 LinkDB All DBs Position 37:complement(33896749..33898789) Genome browser AA seq 75 aa AA seqDB search MSGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtccggacaggaggatccagtgcaacgagaaattcaccaagactgggcgaatcgggaa tacatcgaagtgatcaccagcagcattaagaaaatcgccgatttcctcaattccttcgat atgtcctgcaggtcccgtttagccactctgaatgagaaacttaccgctctggagagaagg atcgagtatatcgaagccagggtcacaaaaggggaaaccttgacttaa

DBGET integrated database retrieval system