Myxocyprinus asiaticus (Chinese sucker): 127431435 Help Entry 127431435         CDS       T08782                                  Name (RefSeq) elongin-C-like isoform X1   KO K03872   elongin-C Organism masi  Myxocyprinus asiaticus (Chinese sucker) Pathway masi04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:masi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     127431435  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:masi04121]     127431435    03400 DNA repair and recombination proteins [BR:masi03400]     127431435 Ubiquitin system [BR:masi04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      127431435    Cul5 complex      127431435 DNA repair and recombination proteins [BR:masi03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      127431435 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  127431435 NCBI-ProteinID:  XP_051537778 LinkDB All DBs Position 41:complement(22102497..22104048) Genome browser AA seq 113 aa AA seqDB search MADVEERIYGGCEGPDAMHVKLISTDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNE VNFREIPSHVLSKVCMYLTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcagatgttgaagagaggatttacggtggttgcgagggcccagatgctatgcacgta aagttgatctccacagatggtcatgagtttattgtgaagagagaacatgctttaacctct ggcaccatcaaagctatgctgagtggacctggtcagtttgctgaaaatgaaaccaatgag gtaaacttccgagagatcccttctcacgttctctccaaagtgtgcatgtatttgacctac aaagttcgttataccaacagctcaacagaaattccagaattccccattgctcctgagatt gcactggaactgctcatggctgcaaacttcctagactgttag

DBGET integrated database retrieval system