Myxocyprinus asiaticus (Chinese sucker): 127433761 Help Entry 127433761         CDS       T08782                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism masi  Myxocyprinus asiaticus (Chinese sucker) Pathway masi04137   Mitophagy - animal masi04140   Autophagy - animal masi04144   Endocytosis masi04145   Phagosome masi04148   Efferocytosis masi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:masi00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     127433761    04145 Phagosome     127433761    04140 Autophagy - animal     127433761    04137 Mitophagy - animal     127433761    04148 Efferocytosis     127433761  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127433761  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:masi04131]     127433761   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:masi04147]     127433761    04031 GTP-binding proteins [BR:masi04031]     127433761 Membrane trafficking [BR:masi04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     127433761 Exosome [BR:masi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127433761   Exosomal proteins of other body fluids (saliva and urine)    127433761   Exosomal proteins of colorectal cancer cells    127433761   Exosomal proteins of bladder cancer cells    127433761 GTP-binding proteins [BR:masi04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     127433761 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA cobW ATP_bind_1 nSTAND3 PduV-EutP Septin AAA_16 AAA_7 AAA_22 NTPase_1 AAA_24 SRPRB AAA_5 G-alpha DUF5992 ATPase_2 NB-ARC NACHT ABC_tran AAA_14 ATP-synt_ab Motif Other DBs NCBI-GeneID:  127433761 NCBI-ProteinID:  XP_051541901 LinkDB All DBs Position 43:complement(31248893..31256543) Genome browser AA seq 205 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF LVLGNKIDLENRQVTTKRALAWCQSKSNIPYFETSAKEAINVDQAFQTIARNALKQESEV ETYDFPDQIKLRDDRPVSSGDGCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcttctcgtaaaaaggtgctcctgaaggttatcattcttggggattctggcgttgga aagacctctttgatgaaccaatatgtcaataagaaatttagcaatcagtataaagccacg atcggggcagactttcttactaaggaggtgatggtggatgacaggctggtgacaatgcag atttgggacacagcaggacaggagcggttccaatcgttgggcgtggctttttatcgagga gcagactgctgcgtgctggtgtatgacgtgacagcgccaaacaccttcaaaaccctggac agctggagggacgagttcctcattcaggccagtccacgagacccagagaacttccctttt ctagtgcttggcaacaagattgatttagagaacagacaggtgacaacaaaacgggccctg gcatggtgtcagagcaaaagcaatattccctacttcgagaccagcgcaaaagaggccatc aacgtggaccaggctttccagaccatcgctcgaaacgccctcaaacaggagtctgaagtg gagacgtacgacttcccagaccagatcaaactgagagatgacaggcctgtgtcctctggt gatggctgcagctgctga

DBGET integrated database retrieval system