Myxocyprinus asiaticus (Chinese sucker): 127435195 Help Entry 127435195         CDS       T08782                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism masi  Myxocyprinus asiaticus (Chinese sucker) Pathway masi04010   MAPK signaling pathway masi04068   FoxO signaling pathway masi04081   Hormone signaling masi04114   Oocyte meiosis masi04140   Autophagy - animal masi04150   mTOR signaling pathway masi04810   Regulation of actin cytoskeleton masi04910   Insulin signaling pathway masi04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:masi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127435195    04068 FoxO signaling pathway     127435195    04150 mTOR signaling pathway     127435195   09133 Signaling molecules and interaction    04081 Hormone signaling     127435195  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     127435195   09143 Cell growth and death    04114 Oocyte meiosis     127435195   09142 Cell motility    04810 Regulation of actin cytoskeleton     127435195  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     127435195    04914 Progesterone-mediated oocyte maturation     127435195  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:masi04052]     127435195 Cytokines and neuropeptides [BR:masi04052]  Neuropeptides   Unclassified    127435195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  127435195 NCBI-ProteinID:  XP_051544428 LinkDB All DBs Position 4:complement(32484773..32485532) Genome browser AA seq 91 aa AA seqDB search MAVWFQAGALLFLLAVSSVNASGETHKPLCGSDLVEVIILVCGQKSSYPKRDVDLLLGFL PPQSGQENEVADFVFKDHAELIRKRGIVEQC NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggcagtgtggttccaggctggtgctttgctgttcctgttggctgtctctagtgtcaac gctagtggagaaactcataagcctctgtgtggatctgacctggttgaagtgatcatcctg gtctgtggtcaaaaaagctcttaccccaagagagatgttgatctcctcctgggtttcctt cctcctcaatctggccaggaaaatgaggtggctgacttcgtatttaaagatcatgctgag ctgataaggaagagaggcattgtagagcagtgttga

DBGET integrated database retrieval system