Myxocyprinus asiaticus (Chinese sucker): 127436201 Help Entry 127436201         CDS       T08782                                  Name (RefSeq) GTPase KRas   KO K07827   GTPase KRas Organism masi  Myxocyprinus asiaticus (Chinese sucker) Pathway masi04010   MAPK signaling pathway masi04012   ErbB signaling pathway masi04068   FoxO signaling pathway masi04137   Mitophagy - animal masi04140   Autophagy - animal masi04150   mTOR signaling pathway masi04210   Apoptosis masi04218   Cellular senescence masi04370   VEGF signaling pathway masi04371   Apelin signaling pathway masi04519   Cadherin signaling masi04540   Gap junction masi04625   C-type lectin receptor signaling pathway masi04810   Regulation of actin cytoskeleton masi04910   Insulin signaling pathway masi04912   GnRH signaling pathway masi04914   Progesterone-mediated oocyte maturation masi04916   Melanogenesis Brite KEGG Orthology (KO) [BR:masi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127436201    04012 ErbB signaling pathway     127436201    04370 VEGF signaling pathway     127436201    04371 Apelin signaling pathway     127436201    04068 FoxO signaling pathway     127436201    04150 mTOR signaling pathway     127436201   09133 Signaling molecules and interaction    04519 Cadherin signaling     127436201  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     127436201    04137 Mitophagy - animal     127436201   09143 Cell growth and death    04210 Apoptosis     127436201    04218 Cellular senescence     127436201   09144 Cellular community - eukaryotes    04540 Gap junction     127436201   09142 Cell motility    04810 Regulation of actin cytoskeleton     127436201  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     127436201   09152 Endocrine system    04910 Insulin signaling pathway     127436201    04912 GnRH signaling pathway     127436201    04914 Progesterone-mediated oocyte maturation     127436201    04916 Melanogenesis     127436201  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:masi04131]     127436201   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:masi04031]     127436201 Membrane trafficking [BR:masi04131]  Endocytosis   Macropinocytosis    Ras GTPases     127436201 GTP-binding proteins [BR:masi04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     127436201 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase MeaB FeoB_N G1_gp67_C ATP_bind_1 Septin DUF6974 NPR1_interact Motif Other DBs NCBI-GeneID:  127436201 NCBI-ProteinID:  XP_051546177 LinkDB All DBs Position 46:24044766..24095625 Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKEGKKKKKK SKTKCVLM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgacggaatataagcttgtggtcgtgggggctggaggtgtcggcaagagcgcgcttacc atacaactcatccagaaccactttgtggatgaatacgacccaactatagaggattcatac aggaagcaggtggtgattgatggagagacatgtctactggatatcttggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggggagggcttcctctgt gtctttgccattaataacaccaagtcctttgaggacattcaccactacagagagcagata aagagagtaaaagactctgaggatgtccccatggtcctagtggggaataagtgtgatctt ccatcccgcactgtggacaccaagcaggctcaggatttagcacgtagctatggcattcca ttcatagagacctcagcaaagacaagacagggtgtggacgacgcattttatacattagtc cgagaaatccggaaacacaaggagaagatgagcaaggaaggcaagaagaagaaaaagaaa tccaagacaaaatgtgtactaatgtga

DBGET integrated database retrieval system