Myxocyprinus asiaticus (Chinese sucker): 127443401 Help Entry 127443401         CDS       T08782                                  Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism masi  Myxocyprinus asiaticus (Chinese sucker) Pathway masi04060   Cytokine-cytokine receptor interaction masi04218   Cellular senescence masi04620   Toll-like receptor signaling pathway masi04621   NOD-like receptor signaling pathway masi04622   RIG-I-like receptor signaling pathway masi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:masi00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     127443401  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     127443401  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     127443401    04621 NOD-like receptor signaling pathway     127443401    04622 RIG-I-like receptor signaling pathway     127443401  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127443401  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:masi04052]     127443401    00536 Glycosaminoglycan binding proteins [BR:masi00536]     127443401 Cytokines and neuropeptides [BR:masi04052]  Cytokines   Chemokines    127443401 Glycosaminoglycan binding proteins [BR:masi00536]  Heparan sulfate / Heparin   Chemokines    127443401 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  127443401 NCBI-ProteinID:  XP_051557939 LinkDB All DBs Position 7:complement(41479144..41480443) Genome browser AA seq 98 aa AA seqDB search MNSKIVYLSIILFVAYLTSSEGMNLRGLGVDPRCRCIETESRRIGKLIASVEIFPPSPHC KDTEIIATLKGTMEEICLDPTAPWVKKVIEKFLANKAP NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaacagcaaaattgtctacctgtctattattttgttcgtggcatatctgaccagcagt gaaggaatgaatctgagaggtctgggtgtagatccacgctgtcgctgcattgaaacagag agtcggcgcattggtaaactaatcgcgagtgtggaaatcttcccccccagcccacactgc aaagacacagagatcattgccactctgaagggcaccatggaggagatctgtttggaccct actgccccatgggttaagaaggttattgagaagtttcttgccaacaaagcaccatga

DBGET integrated database retrieval system