Myxocyprinus asiaticus (Chinese sucker): 127444007 Help Entry 127444007         CDS       T08782                                  Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism masi  Myxocyprinus asiaticus (Chinese sucker) Pathway masi03030   DNA replication masi03410   Base excision repair masi03420   Nucleotide excision repair masi03430   Mismatch repair masi03440   Homologous recombination Brite KEGG Orthology (KO) [BR:masi00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     127444007    03410 Base excision repair     127444007    03420 Nucleotide excision repair     127444007    03430 Mismatch repair     127444007    03440 Homologous recombination     127444007  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:masi03032]     127444007    03400 DNA repair and recombination proteins [BR:masi03400]     127444007 DNA replication proteins [BR:masi03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     127444007 DNA repair and recombination proteins [BR:masi03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       127444007    MMR (mismatch excision repair)     DNA polymerase delta complex      127444007 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  127444007 NCBI-ProteinID:  XP_051559094 LinkDB All DBs Position 7:complement(14422844..14424461) Genome browser AA seq 116 aa AA seqDB search MTVQQHLDMTPKRGLITDTYKVVKKARRGGKRDKSPTPPRAEPEPPQLSEREKDLLELKK FDLDWRFGPCTGISRLQRWERAALHGLDPPQEIKDILLKEKTDREYTQSLWCDYPL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgactgtccaacaacatttagatatgacacctaagcgtggcctcatcaccgacacgtat aaggttgtaaagaaagcaaggagaggtggcaagagagacaagtctcctacgccaccaaga gcagagcctgagcccccacagctgagtgaaagagaaaaagatctactggagctgaagaag tttgatttggactggaggttcggaccatgcacagggatcagtcgactgcagagatgggag agggccgcactgcatgggttggatcccccacaggagattaaagacattctactgaaggag aaaactgaccgagagtacacacagagtctctggtgtgactatccactctga

DBGET integrated database retrieval system