Myxocyprinus asiaticus (Chinese sucker): 127444404 Help Entry 127444404         CDS       T08782                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism masi  Myxocyprinus asiaticus (Chinese sucker) Brite KEGG Orthology (KO) [BR:masi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:masi03041]     127444404   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:masi04052]     127444404 Spliceosome [BR:masi03041]  Complex B   Other components    Complex B specific factors     127444404 Cytokines and neuropeptides [BR:masi04052]  Neuropeptides   Unclassified    127444404 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Ubiquitin_4 Crinkler Motif Other DBs NCBI-GeneID:  127444404 NCBI-ProteinID:  XP_051559725 LinkDB All DBs Position 7:716075..718969 Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNQEDTIGDLKKLIAAQTGTRWDKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggtggtgtgtaacgatcgactggggaagaaggttcgagtcaaatgcaatcag gaggacacaataggagacttgaagaagttgatcgctgctcagaccggcacacggtgggac aagatcgtgctgaagaaatggtacaccatatttaaagatcacgtgtcactgggagactat gaaatccacgacggcatgaacctcgaactctactaccaatag

DBGET integrated database retrieval system