Myxocyprinus asiaticus (Chinese sucker): 127451369 Help Entry 127451369         CDS       T08782                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism masi  Myxocyprinus asiaticus (Chinese sucker) Pathway masi04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:masi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     127451369  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:masi04121]     127451369    03400 DNA repair and recombination proteins [BR:masi03400]     127451369 Ubiquitin system [BR:masi04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      127451369    Cul5 complex      127451369 DNA repair and recombination proteins [BR:masi03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      127451369 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  127451369 NCBI-ProteinID:  XP_051571982 LinkDB All DBs Position 14:complement(20293016..20300606) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRAPEDQRLYKDDMLLEDNKTLGDC GFTNQTARPQAPATVGLAFRISDDAFEPLRVEPFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtctttttgatgatcagacgtcacaagacgaccatctttacagatgctaaggag tccaccacagtgtatgaactgaagcggattgtggagggcatcctaaagcgcgcacctgag gatcagaggctttataaggatgacatgttgctagaagataataagactcttggagactgt ggattcacaaaccagacagccaggcctcaggctccggccacagtaggactggcttttcgc atcagtgatgatgcttttgagcctctaagagtagagcccttctccagcccccctgagctt cctgatgtgatgaagcctcaagactcaggcagcactgccaacgaacaagccgtgcagtga

DBGET integrated database retrieval system