Myxocyprinus asiaticus (Chinese sucker): 127451533 Help Entry 127451533         CDS       T08782                                  Name (RefSeq) insulin-1   KO K04526   insulin Organism masi  Myxocyprinus asiaticus (Chinese sucker) Pathway masi04010   MAPK signaling pathway masi04068   FoxO signaling pathway masi04081   Hormone signaling masi04114   Oocyte meiosis masi04140   Autophagy - animal masi04150   mTOR signaling pathway masi04810   Regulation of actin cytoskeleton masi04910   Insulin signaling pathway masi04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:masi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127451533    04068 FoxO signaling pathway     127451533    04150 mTOR signaling pathway     127451533   09133 Signaling molecules and interaction    04081 Hormone signaling     127451533  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     127451533   09143 Cell growth and death    04114 Oocyte meiosis     127451533   09142 Cell motility    04810 Regulation of actin cytoskeleton     127451533  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     127451533    04914 Progesterone-mediated oocyte maturation     127451533  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:masi04052]     127451533 Cytokines and neuropeptides [BR:masi04052]  Neuropeptides   Unclassified    127451533 SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  127451533 NCBI-ProteinID:  XP_051572237 LinkDB All DBs Position 14:22029570..22039040 Genome browser AA seq 83 aa AA seqDB search MHKSGWILISLCAGSLVTHSGGFGDQKLCGIQLVEALLLVCGERGLFYQPGRHVREHTVF RGIVEQCCHNDCDYFDLENYCNT NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgcacaaatctggatggatcctcatatctctgtgtgctggctctctggtgacccatagt ggtggattcggtgatcaaaagctgtgtggtattcagctggtagaagcactgctgcttgtc tgtggtgagaggggcctcttctaccaacctgggaggcatgtcagagaacacacagtattc agaggcattgtagagcagtgctgtcacaatgactgtgactactttgacctagagaattac tgtaacacatag

DBGET integrated database retrieval system