Myxocyprinus asiaticus (Chinese sucker): 127451777 Help Entry 127451777         CDS       T08782                                  Name (RefSeq) GTPase HRas-like   KO K07827   GTPase KRas Organism masi  Myxocyprinus asiaticus (Chinese sucker) Pathway masi04010   MAPK signaling pathway masi04012   ErbB signaling pathway masi04068   FoxO signaling pathway masi04137   Mitophagy - animal masi04140   Autophagy - animal masi04150   mTOR signaling pathway masi04210   Apoptosis masi04218   Cellular senescence masi04370   VEGF signaling pathway masi04371   Apelin signaling pathway masi04540   Gap junction masi04625   C-type lectin receptor signaling pathway masi04810   Regulation of actin cytoskeleton masi04910   Insulin signaling pathway masi04912   GnRH signaling pathway masi04914   Progesterone-mediated oocyte maturation masi04916   Melanogenesis Brite KEGG Orthology (KO) [BR:masi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127451777    04012 ErbB signaling pathway     127451777    04370 VEGF signaling pathway     127451777    04371 Apelin signaling pathway     127451777    04068 FoxO signaling pathway     127451777    04150 mTOR signaling pathway     127451777  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     127451777    04137 Mitophagy - animal     127451777   09143 Cell growth and death    04210 Apoptosis     127451777    04218 Cellular senescence     127451777   09144 Cellular community - eukaryotes    04540 Gap junction     127451777   09142 Cell motility    04810 Regulation of actin cytoskeleton     127451777  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     127451777   09152 Endocrine system    04910 Insulin signaling pathway     127451777    04912 GnRH signaling pathway     127451777    04914 Progesterone-mediated oocyte maturation     127451777    04916 Melanogenesis     127451777  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:masi04131]     127451777   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:masi04031]     127451777 Membrane trafficking [BR:masi04131]  Endocytosis   Macropinocytosis    Ras GTPases     127451777 GTP-binding proteins [BR:masi04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     127451777 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N G-alpha ATP_bind_1 AAA_14 SatRNA_48 Septin Motif Other DBs NCBI-GeneID:  127451777 NCBI-ProteinID:  XP_051572674 LinkDB All DBs Position 14:14625722..14632670 Genome browser AA seq 187 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNVKSFEDVHLYREQINRVKDSDNVPMVLVGNKSDL ASRTVETRQAQELARSYGVPFVETSAKTRQGVEEAFYSLVREIRRYKETNRSNKKSKKHT QRRCTLL NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgacagaatacaagctggtagtagttggggctggtggcgttgggaagagtgcactgacc atccagctcattcaaaaccactttgtagacgagtatgaccccactattgaggactcgtac agaaagcaggttgtgattgacggggagacgtgtttgctggacatcttggacaccgcaggt caggaggagtacagtgccatgagagaccagtatatgaggacaggagagggtttcctgtgt gtatttgccatcaacaacgtcaagtcctttgaggacgtacatctctacagggagcaaata aaccgtgtcaaagacagcgacaatgtaccaatggtgctggtggggaataaaagtgacttg gcctctcgaactgtagagacacgtcaagctcaggagctcgccagaagttatggagtccca ttcgtcgaaacatctgccaagacacgacagggagtggaggaggcattttactctcttgtc cgggagatccgaagatacaaggagacaaaccgtagcaataagaagagcaaaaagcataca caaagacgctgcactcttttatag

DBGET integrated database retrieval system