Myxocyprinus asiaticus (Chinese sucker): 127452252 Help Entry 127452252         CDS       T08782                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism masi  Myxocyprinus asiaticus (Chinese sucker) Pathway masi04010   MAPK signaling pathway masi04012   ErbB signaling pathway masi04068   FoxO signaling pathway masi04137   Mitophagy - animal masi04140   Autophagy - animal masi04144   Endocytosis masi04150   mTOR signaling pathway masi04210   Apoptosis masi04218   Cellular senescence masi04370   VEGF signaling pathway masi04371   Apelin signaling pathway masi04510   Focal adhesion masi04540   Gap junction masi04625   C-type lectin receptor signaling pathway masi04810   Regulation of actin cytoskeleton masi04910   Insulin signaling pathway masi04912   GnRH signaling pathway masi04916   Melanogenesis masi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:masi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127452252    04012 ErbB signaling pathway     127452252    04370 VEGF signaling pathway     127452252    04371 Apelin signaling pathway     127452252    04068 FoxO signaling pathway     127452252    04150 mTOR signaling pathway     127452252  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     127452252    04140 Autophagy - animal     127452252    04137 Mitophagy - animal     127452252   09143 Cell growth and death    04210 Apoptosis     127452252    04218 Cellular senescence     127452252   09144 Cellular community - eukaryotes    04510 Focal adhesion     127452252    04540 Gap junction     127452252   09142 Cell motility    04810 Regulation of actin cytoskeleton     127452252  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     127452252   09152 Endocrine system    04910 Insulin signaling pathway     127452252    04912 GnRH signaling pathway     127452252    04916 Melanogenesis     127452252  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127452252  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:masi04131]     127452252   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:masi04147]     127452252    04031 GTP-binding proteins [BR:masi04031]     127452252 Membrane trafficking [BR:masi04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     127452252  Endocytosis   Macropinocytosis    Ras GTPases     127452252 Exosome [BR:masi04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    127452252   Exosomal proteins of colorectal cancer cells    127452252 GTP-binding proteins [BR:masi04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     127452252 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  127452252 NCBI-ProteinID:  XP_051573560 LinkDB All DBs Position 2:complement(50699463..50708195) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDDNGQD CMNCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggaatataagttggtggtggtaggtgcaggtggcgtgggcaaaagtgctctgacc atccagctcatccagaaccactttgttgatgaatacgacccaaccattgaggactcatac agaaaacaggtggtgattgatggagagacatgtctgttggatatccttgatactgcaggt caggaagagtacagtgcaatgagagaccagtacatgaggaccggagagggctttctctgt gtctttgccatcaacaataccaagtcttttgaggacattcatcagtacagggaacagatt aaaagggtcaaagactctgatgatgtgcctatggtgcttgtgggcaataaatgtgacctg ccagcacgcacagtggacacgaggcaagcccaggaactggcccgtagctatggtataccc tacattgaaacctcagccaaaacgagacagggagtggaagatgccttttacacacttgtc cgtgaaatcaggcagcacaagttgaggaaactgaacccaccagatgacaacggccaagac tgtatgaattgccgttgtgtggtgtcatga

DBGET integrated database retrieval system