Myxocyprinus asiaticus (Chinese sucker): 127453343 Help Entry 127453343         CDS       T08782                                  Name (RefSeq) C-X-C motif chemokine 19   KO K10030   interleukin 8 Organism masi  Myxocyprinus asiaticus (Chinese sucker) Pathway masi04060   Cytokine-cytokine receptor interaction masi04218   Cellular senescence masi04620   Toll-like receptor signaling pathway masi04621   NOD-like receptor signaling pathway masi04622   RIG-I-like receptor signaling pathway masi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:masi00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     127453343  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     127453343  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     127453343    04621 NOD-like receptor signaling pathway     127453343    04622 RIG-I-like receptor signaling pathway     127453343  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127453343  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:masi04052]     127453343    00536 Glycosaminoglycan binding proteins [BR:masi00536]     127453343 Cytokines and neuropeptides [BR:masi04052]  Cytokines   Chemokines    127453343 Glycosaminoglycan binding proteins [BR:masi00536]  Heparan sulfate / Heparin   Chemokines    127453343 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  127453343 NCBI-ProteinID:  XP_051575639 LinkDB All DBs Position 2:complement(62974606..62981264) Genome browser AA seq 98 aa AA seqDB search MNFLLMLTFITASIHLSNAMQPLGAGYNSHCMCLKLESRVIPPDNLRSVEILPRGPHCKA TEVIAGLSSGEKICLNPRTPWVKKLIHFIEKKRGIKKY NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaacttcctcctgatgttaaccttcattacagccagcattcatctttccaatgcgatg cagcctcttggtgcaggttacaacagccactgcatgtgtttgaaacttgagtcgagggta atcccaccggacaacctccgaagcgtggagatcctgcctagaggtcctcactgcaaggct acagaggttattgctggtttatcgagtggagagaagatctgcctgaaccccagaacacca tgggttaaaaaactcattcactttattgagaaaaaacgagggatcaagaaatattaa

DBGET integrated database retrieval system