Myxocyprinus asiaticus (Chinese sucker): 127454179 Help Entry 127454179         CDS       T08782                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism masi  Myxocyprinus asiaticus (Chinese sucker) Pathway masi04382   Cornified envelope formation masi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:masi00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     127454179  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127454179  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:masi04147]     127454179 Exosome [BR:masi04147]  Exosomal proteins   Exosomal proteins of microglial cells    127454179 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 EH Motif Other DBs NCBI-GeneID:  127454179 NCBI-ProteinID:  XP_051577152 LinkDB All DBs Position 16:complement(26144731..26146251) Genome browser AA seq 103 aa AA seqDB search MPSDLERAMETMIVVFHRYAGREGISTTLSRRELKQLMETELSSFLKSQKDAAAVDKIMK DLDANGDGEVNFEEFVSLVVGLSIACEQIYQIKQKQTLGQKKP NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgccgtctgatctggagagagcaatggaaacaatgattgtggtgtttcatcgttatgcg ggcagagagggtattagtacaaccctgagccgcagagagctcaaacaactgatggagaca gaactgtctagctttcttaagtctcagaaggatgctgcggccgtagacaagattatgaag gatctggatgctaatggggatggagaagtaaattttgaggagtttgtgtctcttgtggtg ggcttgtccattgcctgcgagcagatctaccagataaagcagaagcagacattgggtcag aaaaagccatga

DBGET integrated database retrieval system