Massilia violaceinigra: CR152_02915 Help Entry CR152_02915       CDS       T05157                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mass  Massilia violaceinigra Pathway mass01100   Metabolic pathways mass01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mass00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CR152_02915    00074 Mycolic acid biosynthesis     CR152_02915   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CR152_02915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ATQ73571 UniProt:  A0A2D2DF06 LinkDB All DBs Position 620967..621212 Genome browser AA seq 81 aa AA seqDB search MYLEDIKTILTDVLSLGDAGKELNEQSALLGSIPELDSMAVVNLMAALEEHFGITIDDDE ISASTFETLGSLNAFVKQKLA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgtatctcgaagacatcaaaaccatcctcaccgacgtgctcagcctgggcgatgccggc aaggaactgaacgaacaatccgccctgctgggcagcatccccgagctcgactcgatggcg gtggtgaacctcatggccgcgctggaagagcatttcggcatcaccatcgacgacgatgaa atcagcgcgagtacctttgaaacgctgggcagcctgaatgcgttcgtgaagcaaaaactg gcctga

DBGET integrated database retrieval system