Massilia sp. WG5: AM586_05740 Help Entry AM586_05740       CDS       T04122                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism masw  Massilia sp. WG5 Brite KEGG Orthology (KO) [BR:masw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:masw03036]     AM586_05740 Chromosome and associated proteins [BR:masw03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     AM586_05740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Xol-1_N Motif Other DBs NCBI-ProteinID:  ALK95859 LinkDB All DBs Position 4451259..4451531 Genome browser AA seq 90 aa AA seqDB search MTGKLNVVLTVLVVGCALSVVNARYQRNHLVNDIEKLATQQRQLDIDWSQLQLDQSTLGK NERIEEIARTQLNMTPLSAARTQYLTEGGK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaccggcaagctcaacgtcgtgctgaccgtgctggtggtcggctgcgcgctgtcggtc gtgaacgcccgctaccagcgcaaccacctcgtcaacgacatcgaaaagctggcgacccag cagcgccagctcgacatcgactggtcccagctgcagctcgaccagtccaccctcggcaag aacgagcgcatcgaagagatcgcgcgcacccagctgaacatgacgcccctcagcgcggcg cgtacccagtacctcacggaaggcggcaaatga

DBGET integrated database retrieval system