Massilia sp. WG5: AM586_17485 Help Entry AM586_17485       CDS       T04122                                  Name (GenBank) hypothetical protein   KO K02387   flagellar basal-body rod protein FlgB Organism masw  Massilia sp. WG5 Pathway masw02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:masw00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     AM586_17485  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:masw02035]     AM586_17485 Bacterial motility proteins [BR:masw02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     AM586_17485 SSDB OrthologParalogGFIT Motif Pfam:  Flg_bb_rod Integrin_A_Ig_3 Motif Other DBs NCBI-ProteinID:  ALK97732 LinkDB All DBs Position 1089315..1089617 Genome browser AA seq 100 aa AA seqDB search MGLRAYRQELLASNIANADTPGYKAVDIDINGAIKNGANVDSGVELKYEVQSQGNIDGNT VDMDIARQKFAENALLYEFEVDRVKGFYKSMDDLLKNTPY NT seq 303 nt NT seq  +upstreamnt  +downstreamnt ttgggtttaagggcatatcgtcaggagttgcttgcatcgaacattgcgaacgcggacacg ccagggtacaaggccgtagacatcgatattaacggtgctatcaagaacggggctaacgtg gactccggcgttgaactcaaatatgaggtgcaatcgcaaggcaacattgacggtaatacg gttgatatggatatcgcaaggcagaaattcgcagagaatgcgctgctgtacgagtttgaa gtggatcgggtcaagggattctacaagagtatggacgatctattgaagaacacaccctat tga

DBGET integrated database retrieval system