Massilia sp. WG5: AM586_21105 Help Entry AM586_21105       CDS       T04122                                  Name (GenBank) primosomal protein N   KO K02686   primosomal replication protein N Organism masw  Massilia sp. WG5 Pathway masw03440   Homologous recombination Brite KEGG Orthology (KO) [BR:masw00001]  09120 Genetic Information Processing   09124 Replication and repair    03440 Homologous recombination     AM586_21105  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:masw03400]     AM586_21105 DNA repair and recombination proteins [BR:masw03400]  Prokaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     RecBC pathway proteins      AM586_21105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SSB_1 SSB Motif Other DBs NCBI-ProteinID:  ALK98307 LinkDB All DBs Position complement(1887843..1888136) Genome browser AA seq 97 aa AA seqDB search MNELLLVASIAERDTLRYTPAGIPIVSGTLQHGSQQTEAGIARQVEFEISALAAGDISAR FADAELGAVHRFKGFLARKNRNSKALVFHIIDFSAAA NT seq 294 nt NT seq  +upstreamnt  +downstreamnt gtgaacgagctgttgctggtcgcaagcatcgcggaacgcgataccctgcgctacaccccg gccggcattcccatcgtcagcggcaccctgcaacacgggtcgcagcagacggaggcgggg atcgccaggcaggtcgagttcgagatttccgcgcttgccgcgggcgacatctcggcccgg tttgccgatgcggaactgggtgcggtacaccggttcaagggattcttggccaggaagaac cgcaacagcaaagccctggtgtttcacatcattgatttcagtgccgccgcgtaa

DBGET integrated database retrieval system