KEGG   Pseudoduganella armeniaca: C9I28_12885
Entry
C9I28_12885       CDS       T05378                                 
Name
(GenBank) glycerate dehydrogenase
  KO
K00018  glycerate dehydrogenase [EC:1.1.1.29]
Organism
masz  Pseudoduganella armeniaca
Pathway
masz00260  Glycine, serine and threonine metabolism
masz00630  Glyoxylate and dicarboxylate metabolism
masz00680  Methane metabolism
masz01100  Metabolic pathways
masz01110  Biosynthesis of secondary metabolites
masz01120  Microbial metabolism in diverse environments
masz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:masz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    C9I28_12885
  09102 Energy metabolism
   00680 Methane metabolism
    C9I28_12885
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C9I28_12885
Enzymes [BR:masz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.29  glycerate dehydrogenase
     C9I28_12885
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh
Other DBs
NCBI-ProteinID: AVR96489
UniProt: A0A2R4CA21
LinkDB
Position
complement(2948722..2949672)
AA seq 316 aa
MSEPTSIVFLDRASLVAEVRRPALPHTWTEYDGSTPAEAIERLRGATVAITNKVPLRAEA
LAQLPDLKLIAVAATGTDIIDLAAARERGIVVSNIRDYAHAAVPEHTFALILALRRNLLA
YRADVQAGAWQRSPRFCLFDHPIRDLHGSRLGLVGYGALGRQVAHIGRAFGMEIAVHTRT
PVDGVLNLGLDELLATSDVVSLHAPLTDATRNLVGAAQLARMKPSALLINTARGGLVDEA
ALADALARGVIAGAGFDVLATEPPAPGNVLLNLDLPNFILTPHNAWASREAMQGLADQLI
GNVEAFAAGAPRNVVA
NT seq 951 nt   +upstreamnt  +downstreamnt
atgagcgaaccgacttcgatcgtcttcctcgaccgcgccagcctggtcgccgaggtgcgc
cgtccagcccttccgcatacctggacggagtacgacggcagcacgccggcagaggccatc
gagcgcctgcgcggcgccaccgtcgccatcaccaacaaggtgccgctgcgcgccgaggca
ctggcgcagctgccggacctgaagctgatcgccgtggcggcgacgggcaccgacatcatc
gacctggcggcggcgcgcgagcgcggcatcgtcgtctccaatatccgcgactatgcccat
gcggccgtgccggagcacacctttgcgctgatcctggcactgcgccgcaacctgctggcc
taccgcgccgacgtgcaagccggtgcctggcagcgctcgccccgcttctgcctgttcgac
cacccgatccgcgacctgcacggcagccgcctgggcctggtgggctacggtgcgctgggc
cgccaggtggcgcacatcggccgcgccttcgggatggagatcgccgtgcacacgcgcacg
ccggtggacggcgtcctcaatctcggcctggacgaattgctcgccacctccgacgtggtc
agcctgcatgcaccgttgacggacgccacgcgcaacctggtcggcgccgcccagctggcg
cgcatgaagcccagcgccctgttgatcaataccgcgcgcggcggcctggtggacgaggcg
gcgctggccgacgccctcgcgcgcggcgtcatcgccggtgccggtttcgacgtgctggcg
acggaaccgccggcaccaggcaacgtgctgcttaacctggacctgcccaacttcatcctg
acgccgcacaacgcctgggccagccgcgaggccatgcaggggctggccgaccagttgatc
ggcaacgtggaggcgttcgccgccggcgcgccgcgcaacgtggttgcctga

DBGET integrated database retrieval system