Marivita sp. tig00000067: ACMVPR_03120 Help Entry ACMVPR_03120      CDS       T11113                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism matg  Marivita sp. tig00000067 Pathway matg01100   Metabolic pathways matg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:matg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACMVPR_03120    00074 Mycolic acid biosynthesis     ACMVPR_03120   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACMVPR_03120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  XOY46775 LinkDB All DBs Position 628760..629020 Genome browser AA seq 86 aa AA seqDB search MSVQDRVIRIIADQAMIEPSDVAVTDTMQDLGIDSMGLVECIFALEEEFDIEVPFNANEP EKSDFDISSVASVVAGVEGLIARQKD NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgtgcaagacagggtcattcgcatcatagctgatcaagccatgatcgagccgtct gatgtggccgtgaccgacacgatgcaggacctcggcatcgacagcatgggccttgtggaa tgcatcttcgcgttggaagaagagttcgacatcgaagtgcccttcaacgcgaatgagccg gagaaaagcgattttgacatctcttctgtggcgtcagttgtggctggggtcgaagggttg atcgcccggcaaaaggactga

DBGET integrated database retrieval system