Micromonospora aurantiaca: Micau_4017 Help Entry Micau_4017        CDS       T01296                                  Name (GenBank) phosphopantetheine-binding   KO K05553   minimal PKS acyl carrier protein Organism mau  Micromonospora aurantiaca Pathway mau00253   Tetracycline biosynthesis mau01056   Biosynthesis of type II polyketide backbone mau01100   Metabolic pathways mau01110   Biosynthesis of secondary metabolites Module mau_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:mau00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     Micau_4017    00253 Tetracycline biosynthesis     Micau_4017  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:mau01004]     Micau_4017    01008 Polyketide biosynthesis proteins [BR:mau01008]     Micau_4017 Lipid biosynthesis proteins [BR:mau01004]  Polyketide synthase   Component type    Micau_4017 Polyketide biosynthesis proteins [BR:mau01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      Micau_4017     Nonaketide PKS      Micau_4017     Decaketide PKS      Micau_4017 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1846_C DUF7080 Motif Other DBs NCBI-ProteinID:  ADL47540 LinkDB All DBs Position complement(4560101..4560370) Genome browser AA seq 89 aa AA seqDB search MSQSVRLSVPDLLTILATCAGEAEPVDAAAEDLGEVPLADLGYDSLALLEASSAVERRFG ISLPEEEVAEVRTLNQLGDLVNDRLAQVR NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagtcaatccgtccgattgagcgttcccgatctgctgaccatcctggccacctgcgcc ggcgaagcggagcccgtcgacgcggccgccgaagacctcggcgaggtcccgctggccgac ctgggctacgactccctcgcgttgctcgaagcgtcgagcgccgtcgaacggcggttcggt atctcgctgcccgaggaggaggtggccgaggtgcggacgctgaatcagctaggcgacctg gtcaatgaccgcctcgcccaggtccggtga

DBGET integrated database retrieval system