Micromonospora aurantiaca: Micau_5290 Help Entry Micau_5290        CDS       T01296                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism mau  Micromonospora aurantiaca Brite KEGG Orthology (KO) [BR:mau00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     Micau_5290 Enzymes [BR:mau01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      Micau_5290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 Glrx-like GST_N_3 Thioredoxin_2 Thioredoxin Motif Other DBs NCBI-ProteinID:  ADL48796 LinkDB All DBs Position 5943156..5943398 Genome browser AA seq 80 aa AA seqDB search MLTMYSTPWCGYCHRLKSQLDREGIAYEVVDIEQDPTAADFVMGVNGGNQTVPTLRFADG SALTNPSITQVKQHLAALPG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgctgacgatgtattccaccccgtggtgcggctactgccaccggctgaagtcgcagctc gaccgggagggcatcgcgtacgaggtggtcgacatcgagcaggacccgacggccgcggac ttcgtgatgggcgtcaacggcggtaaccagaccgtcccgacgctgcgcttcgccgacggc agcgccctgaccaacccttcgatcacccaggtcaagcagcacctggccgcgctgcccggc tga

DBGET integrated database retrieval system