Mesocricetus auratus (golden hamster): 101822745 Help Entry 101822745         CDS       T08306                                  Symbol Sst Name (RefSeq) somatostatin   KO K05237   somatostatin Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04024   cAMP signaling pathway maua04080   Neuroactive ligand-receptor interaction maua04081   Hormone signaling maua04935   Growth hormone synthesis, secretion and action maua04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:maua00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     101822745 (Sst)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     101822745 (Sst)    04081 Hormone signaling     101822745 (Sst)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     101822745 (Sst)   09154 Digestive system    04971 Gastric acid secretion     101822745 (Sst)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:maua04052]     101822745 (Sst) Cytokines and neuropeptides [BR:maua04052]  Neuropeptides   GPCR binding    101822745 (Sst) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  101822745 NCBI-ProteinID:  XP_005071662 UniProt:  A0A1U7QDL0 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MLSCRLQCALAALCIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLPQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggccgcgctctgcatcgtcctggccttgggc ggtgtcaccggcgcgccctcggaccccagactccgccagtttctgcagaagtctctggcg gccgctgcaggaaaacaggaactggccaagtacttcctggcagagctgctgtccgagccc aaccagaccgagaatgatgccctggagcccgaggatttgccccaggcagcggagcaggac gaaatgaggctggagctgcagaggtctgccaattcgaacccagccatggcaccccgggaa cgcaaagctggctgcaagaatttcttctggaagacattcacatcctgctag

DBGET integrated database retrieval system