Mesocricetus auratus (golden hamster): 101823676 Help Entry 101823676         CDS       T08306                                  Symbol Nppc Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04022   cGMP-PKG signaling pathway maua04081   Hormone signaling maua04270   Vascular smooth muscle contraction maua05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:maua00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     101823676 (Nppc)   09133 Signaling molecules and interaction    04081 Hormone signaling     101823676 (Nppc)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     101823676 (Nppc)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101823676 (Nppc)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:maua04052]     101823676 (Nppc) Cytokines and neuropeptides [BR:maua04052]  Neuropeptides   Unclassified    101823676 (Nppc) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  101823676 NCBI-ProteinID:  XP_005082307 UniProt:  A0A1U7R976 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MHLSQLIACALLLTLLSLRPSEAKPGTPPKGPRTPPGDELAEPQAAGGNQKKGDKTPGGG GANLKGDRSRLLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgatcgcctgtgccctgctgctcacgttactctcactccggccc tccgaagccaaacccgggacgccaccgaagggcccgcgaacccctcctggggatgagttg gcagagccccaggcagctggtggcaatcagaaaaagggtgacaagactcctggcggcggg ggcgccaatcttaagggagaccgatcgcgactgctccgggacctgcgcgtggacaccaag tcccgggctgcttgggcccgccttctgcacgagcaccccaacgcgcgcaaatacaaaggc ggcaacaagaagggcttgtccaaaggctgctttggcctcaagctggaccggatcggctcc atgagcggtctgggatgttag

DBGET integrated database retrieval system