Mesocricetus auratus (golden hamster): 101826148
Help
Entry
101826148 CDS
T08306
Symbol
Ndufs3
Name
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
KO
K03936
NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:
7.1.1.2
]
Organism
maua
Mesocricetus auratus (golden hamster)
Pathway
maua00190
Oxidative phosphorylation
maua01100
Metabolic pathways
maua04714
Thermogenesis
maua04723
Retrograde endocannabinoid signaling
maua04932
Non-alcoholic fatty liver disease
maua05010
Alzheimer disease
maua05012
Parkinson disease
maua05014
Amyotrophic lateral sclerosis
maua05016
Huntington disease
maua05020
Prion disease
maua05022
Pathways of neurodegeneration - multiple diseases
maua05208
Chemical carcinogenesis - reactive oxygen species
maua05415
Diabetic cardiomyopathy
Module
maua_M00143
NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:
maua00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
101826148 (Ndufs3)
09150 Organismal Systems
09156 Nervous system
04723 Retrograde endocannabinoid signaling
101826148 (Ndufs3)
09159 Environmental adaptation
04714 Thermogenesis
101826148 (Ndufs3)
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
101826148 (Ndufs3)
09164 Neurodegenerative disease
05010 Alzheimer disease
101826148 (Ndufs3)
05012 Parkinson disease
101826148 (Ndufs3)
05014 Amyotrophic lateral sclerosis
101826148 (Ndufs3)
05016 Huntington disease
101826148 (Ndufs3)
05020 Prion disease
101826148 (Ndufs3)
05022 Pathways of neurodegeneration - multiple diseases
101826148 (Ndufs3)
09166 Cardiovascular disease
05415 Diabetic cardiomyopathy
101826148 (Ndufs3)
09167 Endocrine and metabolic disease
04932 Non-alcoholic fatty liver disease
101826148 (Ndufs3)
Enzymes [BR:
maua01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.2 NADH:ubiquinone reductase (H+-translocating)
101826148 (Ndufs3)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Complex1_30kDa
Motif
Other DBs
NCBI-GeneID:
101826148
NCBI-ProteinID:
XP_005065013
UniProt:
A0A1U7Q371
LinkDB
All DBs
Position
Unknown
AA seq
263 aa
AA seq
DB search
MAAAAARVWWRGLVGAASAARGTGRPSVLSQRVRRESAAADTRPTVRPRNDVTHKELSAF
GEYVAEILPKYVQQVQVTCFNELEICIHPDGVIPVLTFLKDHTNAQFKSLADMTAVDVPT
RQNRFEIVYNLLSLRFNSRIRVKTYADELTPIESVVSVHKAANWYEREVWDMFGVFFVNH
PDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEA
FPAYRQPPESLKLEAGDKKPEAK
NT seq
792 nt
NT seq
+upstream
nt +downstream
nt
atggcggctgccgcagccagggtctggtggcgtgggctcgtaggggctgcttccgcagcc
agggggactgggcgaccctcagtgctgtcgcaacgggtgaggagggagagcgcggcggct
gacacgcgccccactgtcagaccacggaatgatgtgacccacaaggagctctcagcattt
ggagagtatgtggctgaaatcctacccaagtatgtccaacaagttcaggtgacctgcttc
aatgagttagaaatctgtatccatcctgatggagtcatccctgtgctgactttcctcaag
gaccacaccaatgcacaattcaaatccttggctgacatgacagcagtagatgtcccaact
cggcagaaccgttttgagattgtctacaacctgctgtctctgcgcttcaactctcggatc
cgtgtgaagacctatgcagatgagctgacgcccattgagtctgtagtctctgtgcacaag
gcggccaactggtatgagagggaggtctgggacatgtttggagttttctttgttaaccac
cctgatctaagaaggatcctgacagactatggcttcgagggacatcctttccggaaagac
tttcccctctctggctatgttgagctacgttatgacgatgaggtgaagcgggtcgtggct
gaaccagtggagttggcacaagaattccgcaagtttgacctgaacagtccctgggaggct
ttccctgcctatcgtcagccccctgagagtctcaagcttgaagctggagacaagaagcct
gaagccaagtag
DBGET
integrated database retrieval system