KEGG   Mesocricetus auratus (golden hamster): 101826148
Entry
101826148         CDS       T08306                                 
Symbol
Ndufs3
Name
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2]
Organism
maua  Mesocricetus auratus (golden hamster)
Pathway
maua00190  Oxidative phosphorylation
maua01100  Metabolic pathways
maua04714  Thermogenesis
maua04723  Retrograde endocannabinoid signaling
maua04932  Non-alcoholic fatty liver disease
maua05010  Alzheimer disease
maua05012  Parkinson disease
maua05014  Amyotrophic lateral sclerosis
maua05016  Huntington disease
maua05020  Prion disease
maua05022  Pathways of neurodegeneration - multiple diseases
maua05208  Chemical carcinogenesis - reactive oxygen species
maua05415  Diabetic cardiomyopathy
Module
maua_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:maua00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101826148 (Ndufs3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101826148 (Ndufs3)
  09159 Environmental adaptation
   04714 Thermogenesis
    101826148 (Ndufs3)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101826148 (Ndufs3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101826148 (Ndufs3)
   05012 Parkinson disease
    101826148 (Ndufs3)
   05014 Amyotrophic lateral sclerosis
    101826148 (Ndufs3)
   05016 Huntington disease
    101826148 (Ndufs3)
   05020 Prion disease
    101826148 (Ndufs3)
   05022 Pathways of neurodegeneration - multiple diseases
    101826148 (Ndufs3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101826148 (Ndufs3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101826148 (Ndufs3)
Enzymes [BR:maua01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     101826148 (Ndufs3)
SSDB
Motif
Pfam: Complex1_30kDa
Other DBs
NCBI-GeneID: 101826148
NCBI-ProteinID: XP_005065013
UniProt: A0A1U7Q371
LinkDB
Position
Unknown
AA seq 263 aa
MAAAAARVWWRGLVGAASAARGTGRPSVLSQRVRRESAAADTRPTVRPRNDVTHKELSAF
GEYVAEILPKYVQQVQVTCFNELEICIHPDGVIPVLTFLKDHTNAQFKSLADMTAVDVPT
RQNRFEIVYNLLSLRFNSRIRVKTYADELTPIESVVSVHKAANWYEREVWDMFGVFFVNH
PDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEA
FPAYRQPPESLKLEAGDKKPEAK
NT seq 792 nt   +upstreamnt  +downstreamnt
atggcggctgccgcagccagggtctggtggcgtgggctcgtaggggctgcttccgcagcc
agggggactgggcgaccctcagtgctgtcgcaacgggtgaggagggagagcgcggcggct
gacacgcgccccactgtcagaccacggaatgatgtgacccacaaggagctctcagcattt
ggagagtatgtggctgaaatcctacccaagtatgtccaacaagttcaggtgacctgcttc
aatgagttagaaatctgtatccatcctgatggagtcatccctgtgctgactttcctcaag
gaccacaccaatgcacaattcaaatccttggctgacatgacagcagtagatgtcccaact
cggcagaaccgttttgagattgtctacaacctgctgtctctgcgcttcaactctcggatc
cgtgtgaagacctatgcagatgagctgacgcccattgagtctgtagtctctgtgcacaag
gcggccaactggtatgagagggaggtctgggacatgtttggagttttctttgttaaccac
cctgatctaagaaggatcctgacagactatggcttcgagggacatcctttccggaaagac
tttcccctctctggctatgttgagctacgttatgacgatgaggtgaagcgggtcgtggct
gaaccagtggagttggcacaagaattccgcaagtttgacctgaacagtccctgggaggct
ttccctgcctatcgtcagccccctgagagtctcaagcttgaagctggagacaagaagcct
gaagccaagtag

DBGET integrated database retrieval system