Mesocricetus auratus (golden hamster): 101826238 Help Entry 101826238         CDS       T08306                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04613   Neutrophil extracellular trap formation maua05034   Alcoholism maua05203   Viral carcinogenesis maua05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:maua00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101826238  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101826238   09163 Immune disease    05322 Systemic lupus erythematosus     101826238   09165 Substance dependence    05034 Alcoholism     101826238  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:maua03036]     101826238 Chromosome and associated proteins [BR:maua03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101826238 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  101826238 NCBI-ProteinID:  XP_021080743 UniProt:  A0A1U7QTV0 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgtggtaagggcggcaaaggtcttggtaaaggaggcgccaagcgtcaccgc aaagtcctccgtgacaacatccaggggatcaccaagcccgccatccgccgcctggcccgc cgtggcggagtcaagcgcatctccggccttatctacgaggagacccgcggggtgctgaag gtgttcctggagaacgtgatccgcgacgcggtcacctacacggagcacgccaagcgcaag accgtcactgccatggacgtggtctacgcgctcaagcgacagggccgcacgctctacggc ttcggcggttaa

DBGET integrated database retrieval system