Mesocricetus auratus (golden hamster): 101827688 Help Entry 101827688         CDS       T08306                                  Symbol Pfn3 Name (RefSeq) profilin-3   KO K05759   profilin Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04015   Rap1 signaling pathway maua04810   Regulation of actin cytoskeleton maua05014   Amyotrophic lateral sclerosis maua05132   Salmonella infection Brite KEGG Orthology (KO) [BR:maua00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101827688 (Pfn3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101827688 (Pfn3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101827688 (Pfn3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101827688 (Pfn3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:maua04131]     101827688 (Pfn3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:maua04812]     101827688 (Pfn3)    04147 Exosome [BR:maua04147]     101827688 (Pfn3) Membrane trafficking [BR:maua04131]  Others   Actin-binding proteins    Others     101827688 (Pfn3) Cytoskeleton proteins [BR:maua04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101827688 (Pfn3) Exosome [BR:maua04147]  Exosomal proteins   Proteins found in most exosomes    101827688 (Pfn3) SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  101827688 NCBI-ProteinID:  XP_040612155 UniProt:  A0ABM2YBG6 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRHTFL QTGLSVAGRRCCVIRDYLLAEGDGVLDARTKGLDGRAICVGHTPRALLVLMGRRGVHGGI LNKTVHDLIGGLREQCS NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggtgactggaagggctatatcagtgctgtgctgcgggaccagcgcatcgacgatgtg gccatcgtgggccactcggacaatcgctgcgtgtgggcatcgcggcccgggggtctgctg gcggccatctccccgcaggaggtgggtgtgctcaccgggccggaccggcacacctttctg cagaccggtctgagcgtggcaggtcgccgctgctgcgttatccgcgactacctgctggcc gagggcgacggagtactagacgcacgcaccaagggactggacgggcgagcgatttgcgtg ggccacacgccgcgggctctcctggtgctcatgggcagacgaggcgtgcatggaggcatc cttaacaagacagtgcacgacctgattggcgggctgcgggagcagtgctcctag

DBGET integrated database retrieval system