Mesocricetus auratus (golden hamster): 101828084 Help Entry 101828084         CDS       T08306                                  Symbol Gast Name (RefSeq) gastrin   KO K13768   gastrin Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04081   Hormone signaling maua04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:maua00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     101828084 (Gast)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     101828084 (Gast)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:maua04052]     101828084 (Gast) Cytokines and neuropeptides [BR:maua04052]  Neuropeptides   GPCR binding    101828084 (Gast) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  101828084 NCBI-ProteinID:  XP_005087430 UniProt:  A0A1U7QWK1 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MPRLCVCMVISVLALATFSEASWKPHSHLQDTSSGPGTNWDLEPHQLDQLRPASPHRRQL GIQGPQHFITDLSKKQRPWMEEEEEAYGWMDFGRRSAEEGDQRN NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcctcgactttgcgtgtgcatggtgatctcagtgctggctctggctaccttctctgaa gcttcctggaagccccactcccatctacaggatacatcctctggaccagggaccaactgg gacctggaaccgcaccagctggaccagctacgtccagcctctccccatcgaaggcagctg gggatccagggtcctcaacactttataacagacctgtccaagaagcagaggccatggatg gaggaagaagaagaggcatatggatggatggacttcggccgccgcagtgctgaggaaggg gaccagcgtaactag

DBGET integrated database retrieval system