Mesocricetus auratus (golden hamster): 101828345 Help Entry 101828345         CDS       T08306                                  Name (RefSeq) histone H3   KO K11253   histone H3 Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04613   Neutrophil extracellular trap formation maua05034   Alcoholism maua05202   Transcriptional misregulation in cancer maua05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:maua00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101828345  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     101828345   09163 Immune disease    05322 Systemic lupus erythematosus     101828345   09165 Substance dependence    05034 Alcoholism     101828345  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:maua03036]     101828345   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:maua04147]     101828345 Chromosome and associated proteins [BR:maua03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101828345 Exosome [BR:maua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101828345 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  101828345 NCBI-ProteinID:  XP_012966031 UniProt:  A0A1U8BEY3 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtactaagcagaccgctcgcaagtctaccggcggcaaggccccgcgcaagcag cttgccaccaaggctgcccgcaagagcgccccggccaccggtggcgtgaagaagccccac cgctaccggcccggcaccgtggcgctgcgtgagatccggcgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtcatggcgctgcaggaggccagcgaagcctac ctggtgggtctgtttgaggacaccaacctgtgcgccatccacgccaagcgagtcaccatc atgcccaaggacatccagctggcccgccgcattcgtggggaaagggcttga

DBGET integrated database retrieval system