Mesocricetus auratus (golden hamster): 101829259 Help Entry 101829259         CDS       T08306                                  Symbol Jun Name (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism maua  Mesocricetus auratus (golden hamster) Pathway maua01522   Endocrine resistance maua04010   MAPK signaling pathway maua04012   ErbB signaling pathway maua04024   cAMP signaling pathway maua04137   Mitophagy - animal maua04210   Apoptosis maua04310   Wnt signaling pathway maua04380   Osteoclast differentiation maua04510   Focal adhesion maua04530   Tight junction maua04620   Toll-like receptor signaling pathway maua04621   NOD-like receptor signaling pathway maua04625   C-type lectin receptor signaling pathway maua04657   IL-17 signaling pathway maua04658   Th1 and Th2 cell differentiation maua04659   Th17 cell differentiation maua04660   T cell receptor signaling pathway maua04662   B cell receptor signaling pathway maua04668   TNF signaling pathway maua04722   Neurotrophin signaling pathway maua04912   GnRH signaling pathway maua04915   Estrogen signaling pathway maua04921   Oxytocin signaling pathway maua04926   Relaxin signaling pathway maua04932   Non-alcoholic fatty liver disease maua04933   AGE-RAGE signaling pathway in diabetic complications maua05030   Cocaine addiction maua05031   Amphetamine addiction maua05132   Salmonella infection maua05133   Pertussis maua05135   Yersinia infection maua05140   Leishmaniasis maua05142   Chagas disease maua05161   Hepatitis B maua05162   Measles maua05166   Human T-cell leukemia virus 1 infection maua05167   Kaposi sarcoma-associated herpesvirus infection maua05169   Epstein-Barr virus infection maua05170   Human immunodeficiency virus 1 infection maua05171   Coronavirus disease - COVID-19 maua05200   Pathways in cancer maua05203   Viral carcinogenesis maua05207   Chemical carcinogenesis - receptor activation maua05208   Chemical carcinogenesis - reactive oxygen species maua05210   Colorectal cancer maua05211   Renal cell carcinoma maua05224   Breast cancer maua05231   Choline metabolism in cancer maua05235   PD-L1 expression and PD-1 checkpoint pathway in cancer maua05321   Inflammatory bowel disease maua05323   Rheumatoid arthritis maua05417   Lipid and atherosclerosis maua05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:maua00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101829259 (Jun)    04012 ErbB signaling pathway     101829259 (Jun)    04310 Wnt signaling pathway     101829259 (Jun)    04668 TNF signaling pathway     101829259 (Jun)    04024 cAMP signaling pathway     101829259 (Jun)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     101829259 (Jun)   09143 Cell growth and death    04210 Apoptosis     101829259 (Jun)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101829259 (Jun)    04530 Tight junction     101829259 (Jun)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101829259 (Jun)    04621 NOD-like receptor signaling pathway     101829259 (Jun)    04625 C-type lectin receptor signaling pathway     101829259 (Jun)    04660 T cell receptor signaling pathway     101829259 (Jun)    04658 Th1 and Th2 cell differentiation     101829259 (Jun)    04659 Th17 cell differentiation     101829259 (Jun)    04657 IL-17 signaling pathway     101829259 (Jun)    04662 B cell receptor signaling pathway     101829259 (Jun)   09152 Endocrine system    04912 GnRH signaling pathway     101829259 (Jun)    04915 Estrogen signaling pathway     101829259 (Jun)    04921 Oxytocin signaling pathway     101829259 (Jun)    04926 Relaxin signaling pathway     101829259 (Jun)   09156 Nervous system    04722 Neurotrophin signaling pathway     101829259 (Jun)   09158 Development and regeneration    04380 Osteoclast differentiation     101829259 (Jun)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101829259 (Jun)    05207 Chemical carcinogenesis - receptor activation     101829259 (Jun)    05208 Chemical carcinogenesis - reactive oxygen species     101829259 (Jun)    05203 Viral carcinogenesis     101829259 (Jun)    05231 Choline metabolism in cancer     101829259 (Jun)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101829259 (Jun)   09162 Cancer: specific types    05210 Colorectal cancer     101829259 (Jun)    05211 Renal cell carcinoma     101829259 (Jun)    05224 Breast cancer     101829259 (Jun)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101829259 (Jun)    05170 Human immunodeficiency virus 1 infection     101829259 (Jun)    05161 Hepatitis B     101829259 (Jun)    05171 Coronavirus disease - COVID-19     101829259 (Jun)    05162 Measles     101829259 (Jun)    05167 Kaposi sarcoma-associated herpesvirus infection     101829259 (Jun)    05169 Epstein-Barr virus infection     101829259 (Jun)   09171 Infectious disease: bacterial    05132 Salmonella infection     101829259 (Jun)    05135 Yersinia infection     101829259 (Jun)    05133 Pertussis     101829259 (Jun)   09174 Infectious disease: parasitic    05140 Leishmaniasis     101829259 (Jun)    05142 Chagas disease     101829259 (Jun)   09163 Immune disease    05323 Rheumatoid arthritis     101829259 (Jun)    05321 Inflammatory bowel disease     101829259 (Jun)   09165 Substance dependence    05030 Cocaine addiction     101829259 (Jun)    05031 Amphetamine addiction     101829259 (Jun)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101829259 (Jun)    05418 Fluid shear stress and atherosclerosis     101829259 (Jun)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     101829259 (Jun)    04933 AGE-RAGE signaling pathway in diabetic complications     101829259 (Jun)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     101829259 (Jun)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:maua03000]     101829259 (Jun) Transcription factors [BR:maua03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     101829259 (Jun) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha DUF3450 FlaC_arch TFIIA Motif Other DBs NCBI-GeneID:  101829259 NCBI-ProteinID:  XP_012971972 UniProt:  A0A1U8BXK4 LinkDB All DBs Position Unknown AA seq 338 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGNLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGA LSGGGGGGGGAPSYGAAGLAFPPSQPQQQPPQPPPHHLPQQIPVQHPRLQALKEEPQTVP EMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSE LASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tccgagagcggcgcctacggctacagtaaccctaagatcctgaaacagagcatgaccttg aacctggccgacccggtgggcaatctgaagccgcatctccgcgccaagaactcggacctc ctcacgtcgcccgacgttggcttgctcaagctggcgtcgcccgagctggagcgcctgatc atccagtccagcaatgggcacatcaccaccacgccgaccccgacccagttcttgtgcccc aagaacgtgaccgacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcggcggcacaaccggtcagcggtgcg ggcatggtggctcccgcggtggcctcggtagcgggcgctggcggcggcggcggctacagc gccagcctgcacagtgagcctccggtctacgccaacctcagcaacttcaacccgggtgcg ctgagcggcggcggcggcggcggcggcggggcgccctcctacggcgcggccgggctggcc ttccccccgtcgcagccccagcagcagccgccgcagccgccgccgcaccacttgccccaa cagatcccggtgcagcacccgcggctgcaggccctgaaggaagagccccagacggtgccc gagatgccgggagagaccccgcccctgtcccccatcgacatggagtcacaggagcggatc aaggccgagaggaagcgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaag ctggagaggatcgcccggctagaggaaaaagtgaaaaccttgaaagcgcaaaactcggag ctggcgtccacggccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatg aaccacgttaacagtgggtgccagctcatgctaacacagcagttgcaaacgttttga

DBGET integrated database retrieval system