Mesocricetus auratus (golden hamster): 101831337 Help Entry 101831337         CDS       T08306                                  Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism maua  Mesocricetus auratus (golden hamster) Pathway maua03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:maua00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     101831337  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:maua03036]     101831337    03400 DNA repair and recombination proteins [BR:maua03400]     101831337 Chromosome and associated proteins [BR:maua03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      101831337 DNA repair and recombination proteins [BR:maua03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      101831337 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Histone TFIID-31kDa COMMD1_N DUF4087 Bromo_TP TAF Motif Other DBs NCBI-GeneID:  101831337 NCBI-ProteinID:  XP_021088241 UniProt:  A0A3Q0D635 LinkDB All DBs Position Unknown AA seq 134 aa AA seqDB search MEEVGAEEQQRFCQRQRLKAAVHYTVGCLCQEVASDKQVQFSKQTIAAISEVTFRQCENF AKDLEMFARHAKRSTITTEDVKLLARRSNSLLKYITEKNEEIAQLNLERKAKKKRKPEDG NKDSLEPDVDVGEQ NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atggaggaggtgggcgctgaggagcagcagcgattctgtcagcggcagaggctgaaggct gcagttcactacaccgtcggctgtctttgccaggaagttgcgtcggataagcaggtgcag ttcagcaagcagaccattgcagccatctcggaggtgacttttcgacagtgcgaaaatttt gccaaagaccttgaaatgtttgccagacatgctaaaagaagcacgattaccacagaagac gtgaagctcttagccaggcggagtaattcactgctaaaatacatcaccgagaaaaatgaa gagattgctcagcttaacctagagcgaaaggccaagaagaaaaggaagccagaggatggg aacaaggactccttggagcccgatgttgatgtgggtgagcagtga

DBGET integrated database retrieval system