Mesocricetus auratus (golden hamster): 101831918 Help Entry 101831918         CDS       T08306                                  Symbol Rhoa Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04014   Ras signaling pathway maua04015   Rap1 signaling pathway maua04022   cGMP-PKG signaling pathway maua04024   cAMP signaling pathway maua04062   Chemokine signaling pathway maua04071   Sphingolipid signaling pathway maua04072   Phospholipase D signaling pathway maua04144   Endocytosis maua04150   mTOR signaling pathway maua04270   Vascular smooth muscle contraction maua04310   Wnt signaling pathway maua04350   TGF-beta signaling pathway maua04360   Axon guidance maua04510   Focal adhesion maua04520   Adherens junction maua04530   Tight junction maua04611   Platelet activation maua04621   NOD-like receptor signaling pathway maua04625   C-type lectin receptor signaling pathway maua04660   T cell receptor signaling pathway maua04670   Leukocyte transendothelial migration maua04722   Neurotrophin signaling pathway maua04810   Regulation of actin cytoskeleton maua04921   Oxytocin signaling pathway maua04928   Parathyroid hormone synthesis, secretion and action maua04972   Pancreatic secretion maua05100   Bacterial invasion of epithelial cells maua05132   Salmonella infection maua05133   Pertussis maua05135   Yersinia infection maua05152   Tuberculosis maua05163   Human cytomegalovirus infection maua05200   Pathways in cancer maua05203   Viral carcinogenesis maua05205   Proteoglycans in cancer maua05206   MicroRNAs in cancer maua05210   Colorectal cancer maua05417   Lipid and atherosclerosis maua05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:maua00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101831918 (Rhoa)    04015 Rap1 signaling pathway     101831918 (Rhoa)    04310 Wnt signaling pathway     101831918 (Rhoa)    04350 TGF-beta signaling pathway     101831918 (Rhoa)    04072 Phospholipase D signaling pathway     101831918 (Rhoa)    04071 Sphingolipid signaling pathway     101831918 (Rhoa)    04024 cAMP signaling pathway     101831918 (Rhoa)    04022 cGMP-PKG signaling pathway     101831918 (Rhoa)    04150 mTOR signaling pathway     101831918 (Rhoa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101831918 (Rhoa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101831918 (Rhoa)    04520 Adherens junction     101831918 (Rhoa)    04530 Tight junction     101831918 (Rhoa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101831918 (Rhoa)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     101831918 (Rhoa)    04621 NOD-like receptor signaling pathway     101831918 (Rhoa)    04625 C-type lectin receptor signaling pathway     101831918 (Rhoa)    04660 T cell receptor signaling pathway     101831918 (Rhoa)    04670 Leukocyte transendothelial migration     101831918 (Rhoa)    04062 Chemokine signaling pathway     101831918 (Rhoa)   09152 Endocrine system    04921 Oxytocin signaling pathway     101831918 (Rhoa)    04928 Parathyroid hormone synthesis, secretion and action     101831918 (Rhoa)   09153 Circulatory system    04270 Vascular smooth muscle contraction     101831918 (Rhoa)   09154 Digestive system    04972 Pancreatic secretion     101831918 (Rhoa)   09156 Nervous system    04722 Neurotrophin signaling pathway     101831918 (Rhoa)   09158 Development and regeneration    04360 Axon guidance     101831918 (Rhoa)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101831918 (Rhoa)    05206 MicroRNAs in cancer     101831918 (Rhoa)    05205 Proteoglycans in cancer     101831918 (Rhoa)    05203 Viral carcinogenesis     101831918 (Rhoa)   09162 Cancer: specific types    05210 Colorectal cancer     101831918 (Rhoa)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     101831918 (Rhoa)   09171 Infectious disease: bacterial    05132 Salmonella infection     101831918 (Rhoa)    05135 Yersinia infection     101831918 (Rhoa)    05133 Pertussis     101831918 (Rhoa)    05152 Tuberculosis     101831918 (Rhoa)    05100 Bacterial invasion of epithelial cells     101831918 (Rhoa)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101831918 (Rhoa)    05418 Fluid shear stress and atherosclerosis     101831918 (Rhoa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:maua04131]     101831918 (Rhoa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:maua04147]     101831918 (Rhoa)    04031 GTP-binding proteins [BR:maua04031]     101831918 (Rhoa) Membrane trafficking [BR:maua04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     101831918 (Rhoa) Exosome [BR:maua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101831918 (Rhoa)   Exosomal proteins of other body fluids (saliva and urine)    101831918 (Rhoa)   Exosomal proteins of colorectal cancer cells    101831918 (Rhoa)   Exosomal proteins of bladder cancer cells    101831918 (Rhoa) GTP-binding proteins [BR:maua04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     101831918 (Rhoa) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  101831918 NCBI-ProteinID:  XP_040595445 EnsemblRapid:  ENSMAUG00000015113 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLIL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatcaggaagaaactggtgattgttggtgatggagcttgtggtaagacatgc ttgctcatagtcttcagcaaggaccagttcccagaggtttatgtgcccacagtgtttgaa aactacgtggcagatattgaagtggatggaaagcaggtagagttggctttgtgggacaca gctggacaagaagattatgatcgcctgaggcctctctcctatccagacactgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccagaagtcaagcatttctgtcccaatgtgcccattatcctggttgggaacaagaaggat cttcggaatgatgagcacacaagacgggagttagccaaaatgaagcaggagccggtaaaa cctgaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagagaggtttttgaaatggccacgagagctgctctgcaa gccagacgtgggaagaaaaaatctgggtgcctcattttgtga

DBGET integrated database retrieval system