Mesocricetus auratus (golden hamster): 101833122 Help Entry 101833122         CDS       T08306                                  Symbol Dynlt1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04814   Motor proteins maua05132   Salmonella infection Brite KEGG Orthology (KO) [BR:maua00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     101833122 (Dynlt1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101833122 (Dynlt1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:maua03037]     101833122 (Dynlt1)    04812 Cytoskeleton proteins [BR:maua04812]     101833122 (Dynlt1) Cilium and associated proteins [BR:maua03037]  Motile cilia and associated proteins   Dynein arm    101833122 (Dynlt1) Cytoskeleton proteins [BR:maua04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      101833122 (Dynlt1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 P22_AR_C Motif Other DBs NCBI-GeneID:  101833122 NCBI-ProteinID:  XP_005065977 UniProt:  A0A1U7QH56 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MEDFQASEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSHLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggaagacttccaggcttccgaggagactgcatttgttgttgatgaagtgagcaacatt gtaaaggaggctatagaaagtgccatcggtggcaacgcctaccagcacagcaaagtcaat cagtggaccacaaatgttgtagagcagactttgagccacctcaccaagctgggaaaacca tttaaatacattgtgacctgtgtgatcatgcagaagaacggagctgggttacacactgca agttcctgcttctgggacagctctacggacgggagctgcacggtgcgatgggagaacaag accatgtactgcatcgtcagcgccttcgggctgtccatctga

DBGET integrated database retrieval system