Mesocricetus auratus (golden hamster): 101833432 Help Entry 101833432         CDS       T08306                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04613   Neutrophil extracellular trap formation maua05034   Alcoholism maua05202   Transcriptional misregulation in cancer maua05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:maua00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101833432  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     101833432   09163 Immune disease    05322 Systemic lupus erythematosus     101833432   09165 Substance dependence    05034 Alcoholism     101833432  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:maua03036]     101833432   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:maua04147]     101833432 Chromosome and associated proteins [BR:maua03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101833432 Exosome [BR:maua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101833432 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  101833432 NCBI-ProteinID:  XP_005078192 UniProt:  A0A1U7QAZ8 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatccaccggtggtaaagcacccaggaaacaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaatcagacgctatcagaaatccactgaa cttctgattcgcaagctccccttccagcgtctggtgcgagaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctatttgaagataccaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagatatccagctagcacgccgcatacgcggagaacgtgcttaa

DBGET integrated database retrieval system