Mesocricetus auratus (golden hamster): 101835410 Help Entry 101835410         CDS       T08306                                  Symbol Il2 Name (RefSeq) interleukin-2 precursor   KO K05429   interleukin 2 Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04060   Cytokine-cytokine receptor interaction maua04061   Viral protein interaction with cytokine and cytokine receptor maua04151   PI3K-Akt signaling pathway maua04625   C-type lectin receptor signaling pathway maua04630   JAK-STAT signaling pathway maua04658   Th1 and Th2 cell differentiation maua04659   Th17 cell differentiation maua04660   T cell receptor signaling pathway maua04672   Intestinal immune network for IgA production maua04940   Type I diabetes mellitus maua05135   Yersinia infection maua05142   Chagas disease maua05162   Measles maua05166   Human T-cell leukemia virus 1 infection maua05171   Coronavirus disease - COVID-19 maua05200   Pathways in cancer maua05320   Autoimmune thyroid disease maua05321   Inflammatory bowel disease maua05330   Allograft rejection maua05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:maua00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101835410 (Il2)    04151 PI3K-Akt signaling pathway     101835410 (Il2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101835410 (Il2)    04061 Viral protein interaction with cytokine and cytokine receptor     101835410 (Il2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101835410 (Il2)    04660 T cell receptor signaling pathway     101835410 (Il2)    04658 Th1 and Th2 cell differentiation     101835410 (Il2)    04659 Th17 cell differentiation     101835410 (Il2)    04672 Intestinal immune network for IgA production     101835410 (Il2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101835410 (Il2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101835410 (Il2)    05171 Coronavirus disease - COVID-19     101835410 (Il2)    05162 Measles     101835410 (Il2)   09171 Infectious disease: bacterial    05135 Yersinia infection     101835410 (Il2)   09174 Infectious disease: parasitic    05142 Chagas disease     101835410 (Il2)   09163 Immune disease    05320 Autoimmune thyroid disease     101835410 (Il2)    05321 Inflammatory bowel disease     101835410 (Il2)    05330 Allograft rejection     101835410 (Il2)    05332 Graft-versus-host disease     101835410 (Il2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     101835410 (Il2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:maua04052]     101835410 (Il2)    00536 Glycosaminoglycan binding proteins [BR:maua00536]     101835410 (Il2) Cytokines and neuropeptides [BR:maua04052]  Cytokines   Interleukins    101835410 (Il2) Glycosaminoglycan binding proteins [BR:maua00536]  Heparan sulfate / Heparin   Cytokines    101835410 (Il2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL2 Desmo_N Rx_N Motif Other DBs NCBI-GeneID:  101835410 NCBI-ProteinID:  NP_001268558 UniProt:  B3VBJ5 LinkDB All DBs AA seq 155 aa AA seqDB search MYSMQLASCLALTLALLVSSAPTSSSKKETQQHLEQLLLDLQELLKGINNYKNPKLPMML TFKFYMPKKATELKHLQCLEEELGALQSVLDLAQSKSFHLEDAENFISNIRVTVVKLKGS ESTFRCEFDDETVTVVEFLNRWITFCQSSIATMTQ NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtacagcatgcagctcgcatcctgtcttgcactgacgctcgcactccttgtcagcagt gcacccacttcaagctctaaaaaggaaacccagcagcacctcgagcagttactgctggac ttacaggagcttctgaaagggatcaataattacaagaatccgaaactccccatgatgctc acgtttaaattttacatgcccaagaaggccacagaattgaaacatctccagtgcctggaa gaagaacttggagccctgcagagcgtgctggatttggctcaaagcaaaagctttcacttg gaagatgctgagaatttcatcagcaatatcagagtgacagttgtgaaactaaagggctct gaaagcacattcagatgtgaattcgatgatgagacagtaactgtggtggaatttctgaac agatggatcaccttctgtcaaagcagtatcgcaacaatgactcaataa

DBGET integrated database retrieval system