Mesocricetus auratus (golden hamster): 101837062 Help Entry 101837062         CDS       T08306                                  Symbol Arf6 Name (RefSeq) ADP-ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04014   Ras signaling pathway maua04072   Phospholipase D signaling pathway maua04144   Endocytosis maua04517   IgSF CAM signaling maua04666   Fc gamma R-mediated phagosome formation maua05132   Salmonella infection maua05135   Yersinia infection Brite KEGG Orthology (KO) [BR:maua00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101837062 (Arf6)    04072 Phospholipase D signaling pathway     101837062 (Arf6)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     101837062 (Arf6)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101837062 (Arf6)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagosome formation     101837062 (Arf6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101837062 (Arf6)    05135 Yersinia infection     101837062 (Arf6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:maua04131]     101837062 (Arf6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:maua04147]     101837062 (Arf6)    04031 GTP-binding proteins [BR:maua04031]     101837062 (Arf6) Membrane trafficking [BR:maua04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     101837062 (Arf6)   Arf GTPases and associated proteins    Arf GTPases     101837062 (Arf6) Exosome [BR:maua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101837062 (Arf6)   Exosomal proteins of colorectal cancer cells    101837062 (Arf6) GTP-binding proteins [BR:maua04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     101837062 (Arf6) SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  101837062 NCBI-ProteinID:  XP_021084484 UniProt:  A0A3Q0CW99 LinkDB All DBs Position Unknown AA seq 175 aa AA seqDB search MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggggaaggtgctatccaagatcttcgggaacaaggaaatgcggatcctcatgctgggt ctggacgcggccggcaagaccacgatcctgtacaagttgaagctgggccagtctgtgacc accattcccacggtggggttcaacgtggagacggtgacttacaaaaacgtcaagttcaac gtgtgggacgtgggcggccaggacaagatccggccgctctggcggcattactacaccggg acccagggcctgatcttcgtggtggactgcgccgaccgcgaccgcatcgacgaggcccgc caggagctgcaccgcattatcaatgaccgggagatgagggacgccataatcctcatcttc gccaacaagcaggacctgcccgatgccatgaaaccccatgagatccaggagaaactgggc ctgacccggattcgggacaggaactggtatgtgcagccctcctgtgccacctccggggac ggactctatgaggggctcacatggttaacctctaactacaaatcctaa

DBGET integrated database retrieval system