Mesocricetus auratus (golden hamster): 101837271 Help Entry 101837271         CDS       T08306                                  Symbol S100a10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04382   Cornified envelope formation maua05132   Salmonella infection Brite KEGG Orthology (KO) [BR:maua00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     101837271 (S100a10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101837271 (S100a10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:maua04147]     101837271 (S100a10) Exosome [BR:maua04147]  Exosomal proteins   Exosomal proteins of microglial cells    101837271 (S100a10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 Motif Other DBs NCBI-GeneID:  101837271 NCBI-ProteinID:  XP_005080322 UniProt:  A0A1U7QW51 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQMEHAMETMMLTFHRFAGDKDYLTKEDLRVLMEREFPGFLENQKDPLALDKIMKDLD QCRDGKVGFQSFISLVAGLIIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcagatggaacatgccatggaaaccatgatgcttacatttcacagatttgca ggggacaaagactacttaacaaaggaggacctcagggtgctcatggaaagggagttccct gggtttttggaaaatcaaaaggaccccctggctttggacaaaataatgaaggacctggac cagtgccgagatggcaaagtgggcttccagagctttatatccctggttgcagggctcatc attgcatgcaatgactattttgtagtacacatgaagcagaaggggaagaagtag

DBGET integrated database retrieval system