Mesocricetus auratus (golden hamster): 101840179 Help Entry 101840179         CDS       T08306                                  Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04014   Ras signaling pathway maua04015   Rap1 signaling pathway maua04020   Calcium signaling pathway maua04022   cGMP-PKG signaling pathway maua04024   cAMP signaling pathway maua04070   Phosphatidylinositol signaling system maua04114   Oocyte meiosis maua04218   Cellular senescence maua04261   Adrenergic signaling in cardiomyocytes maua04270   Vascular smooth muscle contraction maua04371   Apelin signaling pathway maua04625   C-type lectin receptor signaling pathway maua04713   Circadian entrainment maua04720   Long-term potentiation maua04722   Neurotrophin signaling pathway maua04728   Dopaminergic synapse maua04740   Olfactory transduction maua04744   Phototransduction maua04750   Inflammatory mediator regulation of TRP channels maua04910   Insulin signaling pathway maua04912   GnRH signaling pathway maua04915   Estrogen signaling pathway maua04916   Melanogenesis maua04921   Oxytocin signaling pathway maua04922   Glucagon signaling pathway maua04924   Renin secretion maua04925   Aldosterone synthesis and secretion maua04970   Salivary secretion maua04971   Gastric acid secretion maua05010   Alzheimer disease maua05012   Parkinson disease maua05022   Pathways of neurodegeneration - multiple diseases maua05031   Amphetamine addiction maua05034   Alcoholism maua05133   Pertussis maua05152   Tuberculosis maua05163   Human cytomegalovirus infection maua05167   Kaposi sarcoma-associated herpesvirus infection maua05170   Human immunodeficiency virus 1 infection maua05200   Pathways in cancer maua05214   Glioma maua05417   Lipid and atherosclerosis maua05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:maua00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101840179    04015 Rap1 signaling pathway     101840179    04371 Apelin signaling pathway     101840179    04020 Calcium signaling pathway     101840179    04070 Phosphatidylinositol signaling system     101840179    04024 cAMP signaling pathway     101840179    04022 cGMP-PKG signaling pathway     101840179  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     101840179    04218 Cellular senescence     101840179  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101840179   09152 Endocrine system    04910 Insulin signaling pathway     101840179    04922 Glucagon signaling pathway     101840179    04912 GnRH signaling pathway     101840179    04915 Estrogen signaling pathway     101840179    04921 Oxytocin signaling pathway     101840179    04916 Melanogenesis     101840179    04924 Renin secretion     101840179    04925 Aldosterone synthesis and secretion     101840179   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     101840179    04270 Vascular smooth muscle contraction     101840179   09154 Digestive system    04970 Salivary secretion     101840179    04971 Gastric acid secretion     101840179   09156 Nervous system    04728 Dopaminergic synapse     101840179    04720 Long-term potentiation     101840179    04722 Neurotrophin signaling pathway     101840179   09157 Sensory system    04744 Phototransduction     101840179    04740 Olfactory transduction     101840179    04750 Inflammatory mediator regulation of TRP channels     101840179   09159 Environmental adaptation    04713 Circadian entrainment     101840179  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101840179   09162 Cancer: specific types    05214 Glioma     101840179   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101840179    05163 Human cytomegalovirus infection     101840179    05167 Kaposi sarcoma-associated herpesvirus infection     101840179   09171 Infectious disease: bacterial    05133 Pertussis     101840179    05152 Tuberculosis     101840179   09164 Neurodegenerative disease    05010 Alzheimer disease     101840179    05012 Parkinson disease     101840179    05022 Pathways of neurodegeneration - multiple diseases     101840179   09165 Substance dependence    05031 Amphetamine addiction     101840179    05034 Alcoholism     101840179   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101840179    05418 Fluid shear stress and atherosclerosis     101840179  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:maua01009]     101840179   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:maua04131]     101840179    03036 Chromosome and associated proteins [BR:maua03036]     101840179   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:maua04147]     101840179 Protein phosphatases and associated proteins [BR:maua01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      101840179 Membrane trafficking [BR:maua04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     101840179 Chromosome and associated proteins [BR:maua03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      101840179 Exosome [BR:maua04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    101840179 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 Allatotropin-like_C EH EF_EFCAB10_C SPARC_Ca_bdg UPF0154 EF_SSP120 EFhand_Ca_insen BamM_C EF-hand_EFHB_C DUF5580_M EF-hand_11 Dockerin_1 SAPC2_N EF-hand_STIM1 Caleosin FCaBP_EF-hand DUF1103 dCache_2 RFC1 EF-hand_SWAP70_N SurA_N_3 Motif Other DBs NCBI-GeneID:  101840179 NCBI-ProteinID:  XP_005071796 UniProt:  A0A1U7QRZ9 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MANQLTEEQIAEFKEAFSLFDKDGDGCITTQELGTVMRSLGQNPTEAELQGMVNEIDKDG NGTVDFPEFLSMMSRKMKDTDSEEEIREAFRVFDKDGNGYVSAAELRHVMTRLGEKLSDE EVEEMIQAADTDGDGQVNYEEFVHMLVSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccaaccagctgactgaggagcaaatcgctgagttcaaggaggccttctctctgttc gacaaggatggggatggctgcatcaccacccaggaactgggcactgtcatgcggtccctg ggtcagaatcccacggaggctgagctccagggcatggtgaatgaaatcgacaaggatgga aacggcactgtggacttccccgagttcctgagcatgatgtccaggaagatgaaagacacg gacagcgaggaggagatccgggaggccttccgagtgttcgacaaggacggcaacggctac gtcagcgctgctgaactgaggcatgtgatgaccaggctgggggagaagctgagtgacgag gaggtggaggaaatgatacaggcagcagatacagatggtgatgggcaagtgaactatgag gagtttgtccacatgctagtgtccaagtga

DBGET integrated database retrieval system