Mesocricetus auratus (golden hamster): 101840213 Help Entry 101840213         CDS       T08306                                  Symbol Pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism maua  Mesocricetus auratus (golden hamster) Pathway maua03030   DNA replication maua03410   Base excision repair maua03420   Nucleotide excision repair maua03430   Mismatch repair maua03440   Homologous recombination Brite KEGG Orthology (KO) [BR:maua00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     101840213 (Pold4)    03410 Base excision repair     101840213 (Pold4)    03420 Nucleotide excision repair     101840213 (Pold4)    03430 Mismatch repair     101840213 (Pold4)    03440 Homologous recombination     101840213 (Pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:maua03032]     101840213 (Pold4)    03400 DNA repair and recombination proteins [BR:maua03400]     101840213 (Pold4) DNA replication proteins [BR:maua03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     101840213 (Pold4) DNA repair and recombination proteins [BR:maua03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       101840213 (Pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      101840213 (Pold4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  101840213 NCBI-ProteinID:  XP_040606123 UniProt:  A0ABM2XTV5 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MGRKRFITDSYPVVKKREGPSGHSKGELALELGEDAQSLSQEEAELELLRQFDLAWQYGP CTGITRMQRWHRAEQMGLKPPLEVHQVLKTHPEDPRFQFSLWHLHPL NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgggccggaagcggttcatcactgactcctaccccgttgtgaagaagagggaggggccc tctgggcacagcaagggagagctggcactagagctaggggaagacgcccagtccctcagc caggaggaagcagagctggagctgctgaggcagtttgacctggcctggcagtacgggcct tgcacaggtatcacacggatgcagcgctggcatcgggcagagcagatgggcttgaagccc cctctagaggtacaccaggtgctgaagacacaccctgaagacccccgcttccagttcagc ctctggcatctccacccactctga

DBGET integrated database retrieval system