KEGG   Mesocricetus auratus (golden hamster): 101841668
Entry
101841668         CDS       T08306                                 
Symbol
Mapk3
Name
(RefSeq) LOW QUALITY PROTEIN: mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
maua  Mesocricetus auratus (golden hamster)
Pathway
maua01521  EGFR tyrosine kinase inhibitor resistance
maua01522  Endocrine resistance
maua01524  Platinum drug resistance
maua04010  MAPK signaling pathway
maua04012  ErbB signaling pathway
maua04014  Ras signaling pathway
maua04015  Rap1 signaling pathway
maua04022  cGMP-PKG signaling pathway
maua04024  cAMP signaling pathway
maua04062  Chemokine signaling pathway
maua04066  HIF-1 signaling pathway
maua04068  FoxO signaling pathway
maua04071  Sphingolipid signaling pathway
maua04072  Phospholipase D signaling pathway
maua04114  Oocyte meiosis
maua04140  Autophagy - animal
maua04148  Efferocytosis
maua04150  mTOR signaling pathway
maua04151  PI3K-Akt signaling pathway
maua04210  Apoptosis
maua04218  Cellular senescence
maua04261  Adrenergic signaling in cardiomyocytes
maua04270  Vascular smooth muscle contraction
maua04350  TGF-beta signaling pathway
maua04360  Axon guidance
maua04370  VEGF signaling pathway
maua04371  Apelin signaling pathway
maua04380  Osteoclast differentiation
maua04510  Focal adhesion
maua04517  IgSF CAM signaling
maua04520  Adherens junction
maua04540  Gap junction
maua04550  Signaling pathways regulating pluripotency of stem cells
maua04611  Platelet activation
maua04613  Neutrophil extracellular trap formation
maua04620  Toll-like receptor signaling pathway
maua04621  NOD-like receptor signaling pathway
maua04625  C-type lectin receptor signaling pathway
maua04650  Natural killer cell mediated cytotoxicity
maua04657  IL-17 signaling pathway
maua04658  Th1 and Th2 cell differentiation
maua04659  Th17 cell differentiation
maua04660  T cell receptor signaling pathway
maua04662  B cell receptor signaling pathway
maua04664  Fc epsilon RI signaling pathway
maua04666  Fc gamma R-mediated phagocytosis
maua04668  TNF signaling pathway
maua04713  Circadian entrainment
maua04720  Long-term potentiation
maua04722  Neurotrophin signaling pathway
maua04723  Retrograde endocannabinoid signaling
maua04724  Glutamatergic synapse
maua04725  Cholinergic synapse
maua04726  Serotonergic synapse
maua04730  Long-term depression
maua04810  Regulation of actin cytoskeleton
maua04910  Insulin signaling pathway
maua04912  GnRH signaling pathway
maua04914  Progesterone-mediated oocyte maturation
maua04915  Estrogen signaling pathway
maua04916  Melanogenesis
maua04917  Prolactin signaling pathway
maua04919  Thyroid hormone signaling pathway
maua04921  Oxytocin signaling pathway
maua04926  Relaxin signaling pathway
maua04928  Parathyroid hormone synthesis, secretion and action
maua04929  GnRH secretion
maua04930  Type II diabetes mellitus
maua04933  AGE-RAGE signaling pathway in diabetic complications
maua04934  Cushing syndrome
maua04935  Growth hormone synthesis, secretion and action
maua04960  Aldosterone-regulated sodium reabsorption
maua05010  Alzheimer disease
maua05020  Prion disease
maua05022  Pathways of neurodegeneration - multiple diseases
maua05034  Alcoholism
maua05132  Salmonella infection
maua05133  Pertussis
maua05135  Yersinia infection
maua05140  Leishmaniasis
maua05142  Chagas disease
maua05145  Toxoplasmosis
maua05152  Tuberculosis
maua05160  Hepatitis C
maua05161  Hepatitis B
maua05163  Human cytomegalovirus infection
maua05164  Influenza A
maua05165  Human papillomavirus infection
maua05166  Human T-cell leukemia virus 1 infection
maua05167  Kaposi sarcoma-associated herpesvirus infection
maua05170  Human immunodeficiency virus 1 infection
maua05171  Coronavirus disease - COVID-19
maua05200  Pathways in cancer
maua05203  Viral carcinogenesis
maua05205  Proteoglycans in cancer
maua05206  MicroRNAs in cancer
maua05207  Chemical carcinogenesis - receptor activation
maua05208  Chemical carcinogenesis - reactive oxygen species
maua05210  Colorectal cancer
maua05211  Renal cell carcinoma
maua05212  Pancreatic cancer
maua05213  Endometrial cancer
maua05214  Glioma
maua05215  Prostate cancer
maua05216  Thyroid cancer
maua05218  Melanoma
maua05219  Bladder cancer
maua05220  Chronic myeloid leukemia
maua05221  Acute myeloid leukemia
maua05223  Non-small cell lung cancer
maua05224  Breast cancer
maua05225  Hepatocellular carcinoma
maua05226  Gastric cancer
maua05230  Central carbon metabolism in cancer
maua05231  Choline metabolism in cancer
maua05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
maua05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:maua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101841668 (Mapk3)
   04012 ErbB signaling pathway
    101841668 (Mapk3)
   04014 Ras signaling pathway
    101841668 (Mapk3)
   04015 Rap1 signaling pathway
    101841668 (Mapk3)
   04350 TGF-beta signaling pathway
    101841668 (Mapk3)
   04370 VEGF signaling pathway
    101841668 (Mapk3)
   04371 Apelin signaling pathway
    101841668 (Mapk3)
   04668 TNF signaling pathway
    101841668 (Mapk3)
   04066 HIF-1 signaling pathway
    101841668 (Mapk3)
   04068 FoxO signaling pathway
    101841668 (Mapk3)
   04072 Phospholipase D signaling pathway
    101841668 (Mapk3)
   04071 Sphingolipid signaling pathway
    101841668 (Mapk3)
   04024 cAMP signaling pathway
    101841668 (Mapk3)
   04022 cGMP-PKG signaling pathway
    101841668 (Mapk3)
   04151 PI3K-Akt signaling pathway
    101841668 (Mapk3)
   04150 mTOR signaling pathway
    101841668 (Mapk3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    101841668 (Mapk3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101841668 (Mapk3)
   04148 Efferocytosis
    101841668 (Mapk3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101841668 (Mapk3)
   04210 Apoptosis
    101841668 (Mapk3)
   04218 Cellular senescence
    101841668 (Mapk3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101841668 (Mapk3)
   04520 Adherens junction
    101841668 (Mapk3)
   04540 Gap junction
    101841668 (Mapk3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101841668 (Mapk3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101841668 (Mapk3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101841668 (Mapk3)
   04613 Neutrophil extracellular trap formation
    101841668 (Mapk3)
   04620 Toll-like receptor signaling pathway
    101841668 (Mapk3)
   04621 NOD-like receptor signaling pathway
    101841668 (Mapk3)
   04625 C-type lectin receptor signaling pathway
    101841668 (Mapk3)
   04650 Natural killer cell mediated cytotoxicity
    101841668 (Mapk3)
   04660 T cell receptor signaling pathway
    101841668 (Mapk3)
   04658 Th1 and Th2 cell differentiation
    101841668 (Mapk3)
   04659 Th17 cell differentiation
    101841668 (Mapk3)
   04657 IL-17 signaling pathway
    101841668 (Mapk3)
   04662 B cell receptor signaling pathway
    101841668 (Mapk3)
   04664 Fc epsilon RI signaling pathway
    101841668 (Mapk3)
   04666 Fc gamma R-mediated phagocytosis
    101841668 (Mapk3)
   04062 Chemokine signaling pathway
    101841668 (Mapk3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101841668 (Mapk3)
   04929 GnRH secretion
    101841668 (Mapk3)
   04912 GnRH signaling pathway
    101841668 (Mapk3)
   04915 Estrogen signaling pathway
    101841668 (Mapk3)
   04914 Progesterone-mediated oocyte maturation
    101841668 (Mapk3)
   04917 Prolactin signaling pathway
    101841668 (Mapk3)
   04921 Oxytocin signaling pathway
    101841668 (Mapk3)
   04926 Relaxin signaling pathway
    101841668 (Mapk3)
   04935 Growth hormone synthesis, secretion and action
    101841668 (Mapk3)
   04919 Thyroid hormone signaling pathway
    101841668 (Mapk3)
   04928 Parathyroid hormone synthesis, secretion and action
    101841668 (Mapk3)
   04916 Melanogenesis
    101841668 (Mapk3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101841668 (Mapk3)
   04270 Vascular smooth muscle contraction
    101841668 (Mapk3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101841668 (Mapk3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101841668 (Mapk3)
   04725 Cholinergic synapse
    101841668 (Mapk3)
   04726 Serotonergic synapse
    101841668 (Mapk3)
   04720 Long-term potentiation
    101841668 (Mapk3)
   04730 Long-term depression
    101841668 (Mapk3)
   04723 Retrograde endocannabinoid signaling
    101841668 (Mapk3)
   04722 Neurotrophin signaling pathway
    101841668 (Mapk3)
  09158 Development and regeneration
   04360 Axon guidance
    101841668 (Mapk3)
   04380 Osteoclast differentiation
    101841668 (Mapk3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101841668 (Mapk3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101841668 (Mapk3)
   05206 MicroRNAs in cancer
    101841668 (Mapk3)
   05205 Proteoglycans in cancer
    101841668 (Mapk3)
   05207 Chemical carcinogenesis - receptor activation
    101841668 (Mapk3)
   05208 Chemical carcinogenesis - reactive oxygen species
    101841668 (Mapk3)
   05203 Viral carcinogenesis
    101841668 (Mapk3)
   05230 Central carbon metabolism in cancer
    101841668 (Mapk3)
   05231 Choline metabolism in cancer
    101841668 (Mapk3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101841668 (Mapk3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101841668 (Mapk3)
   05212 Pancreatic cancer
    101841668 (Mapk3)
   05225 Hepatocellular carcinoma
    101841668 (Mapk3)
   05226 Gastric cancer
    101841668 (Mapk3)
   05214 Glioma
    101841668 (Mapk3)
   05216 Thyroid cancer
    101841668 (Mapk3)
   05221 Acute myeloid leukemia
    101841668 (Mapk3)
   05220 Chronic myeloid leukemia
    101841668 (Mapk3)
   05218 Melanoma
    101841668 (Mapk3)
   05211 Renal cell carcinoma
    101841668 (Mapk3)
   05219 Bladder cancer
    101841668 (Mapk3)
   05215 Prostate cancer
    101841668 (Mapk3)
   05213 Endometrial cancer
    101841668 (Mapk3)
   05224 Breast cancer
    101841668 (Mapk3)
   05223 Non-small cell lung cancer
    101841668 (Mapk3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101841668 (Mapk3)
   05170 Human immunodeficiency virus 1 infection
    101841668 (Mapk3)
   05161 Hepatitis B
    101841668 (Mapk3)
   05160 Hepatitis C
    101841668 (Mapk3)
   05171 Coronavirus disease - COVID-19
    101841668 (Mapk3)
   05164 Influenza A
    101841668 (Mapk3)
   05163 Human cytomegalovirus infection
    101841668 (Mapk3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101841668 (Mapk3)
   05165 Human papillomavirus infection
    101841668 (Mapk3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101841668 (Mapk3)
   05135 Yersinia infection
    101841668 (Mapk3)
   05133 Pertussis
    101841668 (Mapk3)
   05152 Tuberculosis
    101841668 (Mapk3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101841668 (Mapk3)
   05140 Leishmaniasis
    101841668 (Mapk3)
   05142 Chagas disease
    101841668 (Mapk3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101841668 (Mapk3)
   05020 Prion disease
    101841668 (Mapk3)
   05022 Pathways of neurodegeneration - multiple diseases
    101841668 (Mapk3)
  09165 Substance dependence
   05034 Alcoholism
    101841668 (Mapk3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101841668 (Mapk3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101841668 (Mapk3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101841668 (Mapk3)
   04934 Cushing syndrome
    101841668 (Mapk3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101841668 (Mapk3)
   01524 Platinum drug resistance
    101841668 (Mapk3)
   01522 Endocrine resistance
    101841668 (Mapk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:maua01001]
    101841668 (Mapk3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:maua03036]
    101841668 (Mapk3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:maua04147]
    101841668 (Mapk3)
Enzymes [BR:maua01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101841668 (Mapk3)
Protein kinases [BR:maua01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101841668 (Mapk3)
Chromosome and associated proteins [BR:maua03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101841668 (Mapk3)
Exosome [BR:maua04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101841668 (Mapk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 101841668
NCBI-ProteinID: XP_040610274
UniProt: A0ABM2Y6B9
LinkDB
Position
Unknown
AA seq 379 aa
MAAATAPGGGGGEPRGAAGVGPGVPGEVEVVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
CKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERL
KELIFQETARFQPGAPEAP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcggcggcgacggctccagggggcgggggcggggagccccggggagccgctggggtc
ggcccgggggtcccgggggaggtggaggtggtgaagggacagccattcgacgtgggccca
cgctacacgcagctgcagtacatcggcgagggcgcgtatggcatggtcagctctgcctac
gaccacgtgcgcaagactagagtggccatcaagaagatcagccccttcgaacatcaaacc
tactgccagcgcacactgagagaaatccagatcttgctgcggttccgccatgagaatgtc
ataggcatccgagacatcctcagagcacccaccctggaagccatgagggatgtttacatt
gttcaggacctcatggagacagacctgtacaagctgcttaagagccagcaactgagcaat
gaccacatctgctacttcctctaccagatccttcggggcctcaagtacatacactcagcc
aatgtgctccatcgggatctgaagccctccaacctgcttatcaacaccacctgcgacctt
aagatctgtgattttggcctggcccggattgctgaccctgagcatgatcacactggcttt
ctgacagagtatgtggccacacgctggtaccgagcaccagagatcatgcttaactccaag
ggctacaccaaatccatcgacatctggtctgtgggctgcattctggctgagatgctctcc
aaccgacccatcttccccggcaagcactacctggaccagctcaaccacattctaggtatc
ttgggctccccatcccaggaggaccttaattgtatcatcaacatgaaggctcgaaactac
ctacagtctctgccctctaaaactaaggtggcatgggccaagctttttcccaaatctgac
tgcaaagccctcgacctgctggaccggatgttgaccttcaaccccaacaagcgcatcaca
gtagaggaggcactggctcacccgtacctggaacagtactatgacccgacagatgagcca
gtggctgaggaacccttcacttttgacatggagctggatgacctccccaaggagaggctg
aaggaactgatcttccaagagacagcccgcttccagcccggggcacccgaggccccctaa

DBGET integrated database retrieval system