Mesocricetus auratus (golden hamster): 101843077 Help Entry 101843077         CDS       T08306                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04613   Neutrophil extracellular trap formation maua05034   Alcoholism maua05202   Transcriptional misregulation in cancer maua05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:maua00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101843077  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     101843077   09163 Immune disease    05322 Systemic lupus erythematosus     101843077   09165 Substance dependence    05034 Alcoholism     101843077  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:maua03036]     101843077   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:maua04147]     101843077 Chromosome and associated proteins [BR:maua03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101843077 Exosome [BR:maua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101843077 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom Bromo_TP PAF Motif Other DBs NCBI-GeneID:  101843077 NCBI-ProteinID:  XP_005079245 UniProt:  A0A1U7QU70 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MAPTKLTASKSTCGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRCYQTSTE LLIRKIPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLSEDTNLCAIHAKRVTI MPKDIQLARRIRGEHA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcctacaaagctgaccgccagcaaatccacctgtggtaaagcacccaggaaacaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggccgggtactgtggcactccgtgaaatcagatgctatcagacatccactgaa cttctgattcgcaagatacccttccagcgtctggtgcgagaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagcgaggcctat ctggttggcctatctgaagataccaacctgtgtgctatccatgccaaacgtgtaacgatt atgccaaaagatatccagctagcacgccgcatacgcggagaacatgcttaa

DBGET integrated database retrieval system