Mesocricetus auratus (golden hamster): 101843124 Help Entry 101843124         CDS       T08306                                  Symbol Il5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04060   Cytokine-cytokine receptor interaction maua04630   JAK-STAT signaling pathway maua04640   Hematopoietic cell lineage maua04657   IL-17 signaling pathway maua04658   Th1 and Th2 cell differentiation maua04660   T cell receptor signaling pathway maua04664   Fc epsilon RI signaling pathway maua04672   Intestinal immune network for IgA production maua05200   Pathways in cancer maua05310   Asthma maua05320   Autoimmune thyroid disease maua05321   Inflammatory bowel disease maua05330   Allograft rejection Brite KEGG Orthology (KO) [BR:maua00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101843124 (Il5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101843124 (Il5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     101843124 (Il5)    04660 T cell receptor signaling pathway     101843124 (Il5)    04658 Th1 and Th2 cell differentiation     101843124 (Il5)    04657 IL-17 signaling pathway     101843124 (Il5)    04664 Fc epsilon RI signaling pathway     101843124 (Il5)    04672 Intestinal immune network for IgA production     101843124 (Il5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101843124 (Il5)   09163 Immune disease    05310 Asthma     101843124 (Il5)    05320 Autoimmune thyroid disease     101843124 (Il5)    05321 Inflammatory bowel disease     101843124 (Il5)    05330 Allograft rejection     101843124 (Il5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:maua04052]     101843124 (Il5)    00536 Glycosaminoglycan binding proteins [BR:maua00536]     101843124 (Il5) Cytokines and neuropeptides [BR:maua04052]  Cytokines   Interleukins    101843124 (Il5) Glycosaminoglycan binding proteins [BR:maua00536]  Heparan sulfate / Heparin   Cytokines    101843124 (Il5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  101843124 NCBI-ProteinID:  XP_040603920 LinkDB All DBs Position Unknown AA seq 132 aa AA seqDB search MRLFLHLSVLTVTCVWAVAMEIPMSTVVKETLIQLSTHRALLTSNETVRLPVPTHKNHQL CIGEIFQGLDILKNQTIRGGTVETLFQNLSLIKKYIDRQKEQCGQERRRARQFLDYLQEF LGVMSTEWTMED NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgaggctgtttctgcacttgagcgttctaactgtcacctgtgtctgggccgtagccatg gagatccccatgagcactgtggtgaaagagaccttgatacagctgtccactcaccgagct ctactgacaagcaacgagacggtgaggcttcctgttcccactcataaaaatcaccagctg tgcatcggagaaatctttcagggtctagacatactgaagaatcaaaccatccgtgggggt accgtggagacgctattccaaaacttgtcattaataaagaaatacattgaccgacaaaaa gagcagtgtggccaggagaggcggagagccaggcagttcctggattacctgcaagagttc cttggtgtgatgagtacagagtggacaatggaagactga

DBGET integrated database retrieval system