Mesocricetus auratus (golden hamster): 101843256 Help Entry 101843256         CDS       T08306                                  Name (RefSeq) histone H2B type 2-F   KO K11252   histone H2B Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04613   Neutrophil extracellular trap formation maua05034   Alcoholism maua05203   Viral carcinogenesis maua05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:maua00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101843256  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101843256   09163 Immune disease    05322 Systemic lupus erythematosus     101843256   09165 Substance dependence    05034 Alcoholism     101843256  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:maua03036]     101843256   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:maua04147]     101843256 Chromosome and associated proteins [BR:maua03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101843256 Exosome [BR:maua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101843256 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like Motif Other DBs NCBI-GeneID:  101843256 NCBI-ProteinID:  XP_021091128 UniProt:  A0A3Q0DEE1 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccggatccggcgaagtctgcccctgctccgaagaagggctcgaagaaagccgtcaca aaagtgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactccgtg tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcctccaaggccatg ggcatcatgaactccttcgtgaacgacatcttcgagcgcatcgcaggcgaggcttcccgc ctggcgcattacaacaagcgttcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggggagctggctaaacacgccgtttcggagggcaccaaggcggtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system