Mesocricetus auratus (golden hamster): 101843827 Help Entry 101843827         CDS       T08306                                  Name (RefSeq) histone H2A-Bbd type 1-like   KO K11251   histone H2A Organism maua  Mesocricetus auratus (golden hamster) Pathway maua03082   ATP-dependent chromatin remodeling maua04217   Necroptosis maua04613   Neutrophil extracellular trap formation maua05034   Alcoholism maua05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:maua00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101843827  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101843827  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101843827  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     101843827   09165 Substance dependence    05034 Alcoholism     101843827  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:maua03036]     101843827   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:maua04147]     101843827 Chromosome and associated proteins [BR:maua03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101843827 Exosome [BR:maua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101843827 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone Motif Other DBs NCBI-GeneID:  101843827 NCBI-ProteinID:  XP_005087182 UniProt:  A0A1U7REM7 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MSGKRQRRSSSRRTKLQFPISQVNRFLREGNWSQRLSSCASVYLTGIAEYLSSNILGLAA MEAHINGKKCITAEHLHQVIQSDEELHQLFTEDATSVVALLDPKGN NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgtcagggaaaaggcaaagacgatccagttccagaagaaccaaacttcaatttcccatt agtcaagtgaatcgcttccttcgagaaggcaactggtcccagcgcctgagctcttgtgct tctgtgtacctgactggtatagcggagtacttgtcatccaacattcttgggctggctgct atggaagcccacattaacggcaagaaatgcatcaccgcagagcacttgcatcaggtgata caaagtgatgaagagctccatcaactcttcacagaagacgccacatctgtggttgctttg ctagaccctaaagggaactga

DBGET integrated database retrieval system