Mesocricetus auratus (golden hamster): 106022079 Help Entry 106022079         CDS       T08306                                  Symbol Elob Name (RefSeq) elongin-B   KO K03873   elongin-B Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04066   HIF-1 signaling pathway maua04120   Ubiquitin mediated proteolysis maua05170   Human immunodeficiency virus 1 infection maua05200   Pathways in cancer maua05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:maua00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     106022079 (Elob)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     106022079 (Elob)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     106022079 (Elob)   09162 Cancer: specific types    05211 Renal cell carcinoma     106022079 (Elob)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     106022079 (Elob)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:maua04121]     106022079 (Elob)    03400 DNA repair and recombination proteins [BR:maua03400]     106022079 (Elob) Ubiquitin system [BR:maua04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      106022079 (Elob)    Cul5 complex      106022079 (Elob) DNA repair and recombination proteins [BR:maua03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      106022079 (Elob) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  106022079 NCBI-ProteinID:  XP_040604148 EnsemblRapid:  ENSMAUG00000027834 LinkDB All DBs Position Unknown AA seq 162 aa AA seqDB search MGGAEGIKGAGRAGPRRARRAALGLPGRGGAWLRRRVEPEAAARMDVFLMIRRHKTTIFT DAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVG LAFRADDAFEALRIEPFSSPPELPDVMKPQDSGGSANEQAVQ NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgggaggggctgaaggaataaagggggcgggccgggcggggccgcgcagagcacgccgg gccgcgcttgggttgccgggaagaggtggagcgtggctgcgccggcgcgtcgagccagaa gcagccgccaggatggacgtctttctcatgatccggcgccacaagaccaccatcttcacg gacgccaaggagtcgagtacggtgttcgagctgaagcgcatcgtcgagggcatcctcaag cggccgccggatgagcagcggctgtacaaggatgaccagctccttgatgatggaaaaact ctgggcgagtgtggcttcactagccagacagcaaggccgcaggccccagccacagtgggc ctggccttccgagcagatgatgcctttgaagccctgcgcattgagcccttttccagccct ccagagcttccagatgtgatgaagccacaggattctggaggcagtgccaatgaacaagct gtgcagtga

DBGET integrated database retrieval system