Mesocricetus auratus (golden hamster): 121133988 Help Entry 121133988         CDS       T08306                                  Symbol Myl10 Name (RefSeq) myosin regulatory light chain 10   KO K12756   myosin regulatory light chain 10 Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04510   Focal adhesion maua04520   Adherens junction maua04670   Leukocyte transendothelial migration maua04810   Regulation of actin cytoskeleton maua04814   Motor proteins maua05132   Salmonella infection Brite KEGG Orthology (KO) [BR:maua00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     121133988 (Myl10)    04520 Adherens junction     121133988 (Myl10)   09142 Cell motility    04814 Motor proteins     121133988 (Myl10)    04810 Regulation of actin cytoskeleton     121133988 (Myl10)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     121133988 (Myl10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121133988 (Myl10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:maua04812]     121133988 (Myl10) Cytoskeleton proteins [BR:maua04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      121133988 (Myl10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 SAPC2_N EF_EFCAB10_C EF-hand_9 AIF-1 EF-hand_FSTL1 Motif Other DBs NCBI-GeneID:  121133988 NCBI-ProteinID:  XP_040587404 UniProt:  A0ABM2W8W5 LinkDB All DBs Position Unknown AA seq 147 aa AA seqDB search MFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINF TVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGVVKADFIKEKLMTQADRFSEEEVKQMF AAFPPDVCGNLDYRNLCYVITHGEEKD NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgtttgaccagtcccagatccaggagtttaaagaggctttcactatcatggaccagaac cgggatggcttcatcgacaaggaagacctgagggacacctttgccgcactgggccgcata aatgtcaagaacgaggagctggaggccatggtgaaggaagctccagggcccatcaacttc acggtcttcctgaccatgtttggggagaagctcaagggcacggacccagaagagaccata ctgcatgccttcaaggtgtttgacactgaaggaaaaggcgtcgtcaaggccgacttcatt aaagagaagcttatgacccaggctgaccggttcagtgaggaggaggtcaagcagatgttt gcagctttccctcctgatgtctgtggcaacttagactacaggaatctgtgctatgtcatc acacacggcgaggagaaggactag

DBGET integrated database retrieval system