Mesocricetus auratus (golden hamster): 121138763 Help Entry 121138763         CDS       T08306                                  Symbol Eloc Name (RefSeq) elongin-C   KO K03872   elongin-C Organism maua  Mesocricetus auratus (golden hamster) Pathway maua04066   HIF-1 signaling pathway maua04120   Ubiquitin mediated proteolysis maua05170   Human immunodeficiency virus 1 infection maua05200   Pathways in cancer maua05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:maua00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     121138763 (Eloc)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     121138763 (Eloc)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121138763 (Eloc)   09162 Cancer: specific types    05211 Renal cell carcinoma     121138763 (Eloc)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     121138763 (Eloc)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:maua04121]     121138763 (Eloc)    03400 DNA repair and recombination proteins [BR:maua03400]     121138763 (Eloc) Ubiquitin system [BR:maua04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      121138763 (Eloc)    Cul5 complex      121138763 (Eloc) DNA repair and recombination proteins [BR:maua03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      121138763 (Eloc) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  121138763 NCBI-ProteinID:  XP_040597344 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMY FTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgtatgtcaagttaatatcttctgatggccatgaatttattgtaaaaagagaacatgcg ttaacatcaggaacaataaaggccatgttgagtggaccagggcagtttgctgagaatgaa accaatgaggtcaattttagagagatcccttcgcatgtgctatcgaaagtgtgcatgtat ttcacctacaaggttcgctacactaacagctccaccgagattcctgaattcccaattgca cctgaaattgcactggaactgctgatggctgcaaacttcctagattgttaa

DBGET integrated database retrieval system