Mesocricetus auratus (golden hamster): 121139105 Help Entry 121139105         CDS       T08306                                  Name (RefSeq) ubiquitin   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism maua  Mesocricetus auratus (golden hamster) Pathway maua03010   Ribosome maua04120   Ubiquitin mediated proteolysis maua04137   Mitophagy - animal maua04140   Autophagy - animal maua05012   Parkinson disease maua05022   Pathways of neurodegeneration - multiple diseases maua05167   Kaposi sarcoma-associated herpesvirus infection maua05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:maua00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     121139105   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     121139105  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121139105    04137 Mitophagy - animal     121139105  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     121139105    05167 Kaposi sarcoma-associated herpesvirus infection     121139105   09164 Neurodegenerative disease    05012 Parkinson disease     121139105    05022 Pathways of neurodegeneration - multiple diseases     121139105  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:maua03011]     121139105    04121 Ubiquitin system [BR:maua04121]     121139105   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:maua04147]     121139105 Ribosome [BR:maua03011]  Ribosomal proteins   Eukaryotes    Small subunit     121139105   Archaea     121139105 Ubiquitin system [BR:maua04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    121139105 Exosome [BR:maua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121139105   Exosomal proteins of colorectal cancer cells    121139105 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Rad60-SLD_2 DUF2604 Dsc3_N Ubiquitin_5 TBK1_ULD OTU1_UBXL Plexin_RBD UBL_UBAC1 Motif Other DBs NCBI-GeneID:  121139105 NCBI-ProteinID:  XP_040597950 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGAKKRKKSYTTPKKNKHKRKKVKLAVLKY NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagattttcgtgaagacccttacggggaaaaccatcacactcgaggttgaaccctcg gacactatagaaaatgtaaaggccaagatccaggataaggaaggaattcctcctgaccag cagaggctgatctttgctggtaagcagctggaagatggccgcacgttgtctgactacaac atccaaaaggagtccacccttcaccttgtgttgagacttcgtggtggtgcgaagaagagg aagaagtcttacaccactcccaagaagaataagcataagagaaagaaggttaagttggct gtgctgaagtactag

DBGET integrated database retrieval system